RegulonDB RegulonDB 10.9: Gene Form
   

ydfU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfU ydfT rem

Gene      
Name: ydfU    Texpresso search in the literature
Synonym(s): ECK1554, G6831, b1560
Genome position(nucleotides): 1643255 <-- 1644304 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.19
External database links:  
ASAP:
ABE-0005209
ECHOBASE:
EB3594
ECOLIHUB:
ydfU
OU-MICROARRAY:
b1560
STRING:
511145.b1560
COLOMBOS: ydfU


Product      
Name: Qin prophage; protein YdfU
Synonym(s): YdfU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.26
Isoelectric point: 8.009
Motif(s):
 
Type Positions Sequence
237 -> 346 EKTVVSITVDPESPESFMKLPKRRRWVKEKYTRWVKTQPCACCGMPADDPHHLIGHGQGGMGTKAHDLFVLPLCRKHHNELHTDTVAFEDKYGSQLELIFRFIDRALAIG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-48000N
ECOCYC:
G6831-MONOMER
ECOLIWIKI:
b1560
INTERPRO:
IPR003615
INTERPRO:
IPR010373
PFAM:
PF06147
PRIDE:
P76162
REFSEQ:
NP_416078
SMART:
SM00507
UNIPROT:
P76162


Operon      
Name: ydfUT         
Operon arrangement:
Transcription unit        Promoter
ydfUT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056


RegulonDB