RegulonDB RegulonDB 11.1: Gene Form

ynfG gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

ynfF ynfH ynfG TSS_1875 TSS_1875

Name: ynfG    Texpresso search in the literature
Synonym(s): ECK1584, G6847, b1589
Genome position(nucleotides): 1662990 --> 1663607
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: putative oxidoreductase YnfG
Synonym(s): YnfG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 22.752
Isoelectric point: 6.135
Type Positions Sequence Comment
5 -> 33 YGFFIDSSRCTGCKTCELACKDFKDLGPE UniProt: 4Fe-4S ferredoxin-type 1.
59 -> 89 FAYYLSISCNHCDDPACTKVCPSGAMHKRED UniProt: 4Fe-4S ferredoxin-type 2.
90 -> 119 GFVVVDEDVCIGCRYCHMACPYGAPQYNAE UniProt: 4Fe-4S ferredoxin-type 3.


Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds
Gene Ontology Terms (GO)  
cellular_component GO:1990204 - oxidoreductase complex
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0009061 - anaerobic respiration
Note(s): Note(s): ...[more].
External database links:  

Name: ynfEFGH-dmsD         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1875 1664208 forward nd [RS-EPT-CBR] [1]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
