RegulonDB RegulonDB 10.9: Gene Form
   

ydgJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydgJ add blr blrp blrp ydgJp6 ydgJp6 TSS_1902 TSS_1902

Gene      
Name: ydgJ    Texpresso search in the literature
Synonym(s): ECK1619, G6868, b1624
Genome position(nucleotides): 1703268 <-- 1704308 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.31
External database links:  
ASAP:
ABE-0005437
ECHOBASE:
EB3690
ECOLIHUB:
ydgJ
OU-MICROARRAY:
b1624
STRING:
511145.b1624
COLOMBOS: ydgJ


Product      
Name: putative oxidoreductase YdgJ
Synonym(s): YdgJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.257
Isoelectric point: 5.588
Motif(s):
 
Type Positions Sequence
5 -> 121 IRVGLIGYGYASKTFHAPLIAGTPGQELAVISSSDETKVKADWPTVTVVSEPKHLFNDPNIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPFTVTLSQARELDALAKSLGRVLSVF
134 -> 342 KGLLAEGVLGEVAYFESHFDRFRPQVRDRWREQGGPGSGIWYDLAPHLLDQAITLFGLPVSMTVDLAQLRPGAQSTDYFHAILSYPQRRVILHGTMLAAAESARYIVHGSRGSYVKYGLDPQEERLKNGERLPQEDWGYDMRDGVLTRVEGEERVEETLLTVPGNYPAYYAAIRDALNGDGENPVPASQAIQVMELIELGIESAKHRAT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11718N
ECOCYC:
G6868-MONOMER
ECOLIWIKI:
b1624
INTERPRO:
IPR004104
INTERPRO:
IPR000683
INTERPRO:
IPR036291
MODBASE:
P77376
PFAM:
PF02894
PFAM:
PF01408
PRIDE:
P77376
REFSEQ:
NP_416141
SMR:
P77376
UNIPROT:
P77376


Operon      
Name: ydgJ         
Operon arrangement:
Transcription unit        Promoter
ydgJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1902 1704331 reverse nd [RS-EPT-CBR] [1]
  promoter ydgJp6 1704399 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB