RegulonDB RegulonDB 10.9: Gene Form
   

cnu gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydgK cnu blr anti-terminator terminator anti-terminator anti-anti-terminator TSS_1907 TSS_1907 TSS_1906 TSS_1906 TSS_1905 TSS_1905 ydgKp ydgKp TSS_1904 TSS_1904 cnup7 cnup7 cnup8 cnup8 cnup10 cnup10 cnup9 cnup9

Gene      
Name: cnu    Texpresso search in the literature
Synonym(s): ECK1621, G6869, b1625, ydgT
Genome position(nucleotides): 1704949 --> 1705164 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.22
External database links:  
ASAP:
ABE-0005443
ECHOBASE:
EB4050
ECOLIHUB:
cnu
OU-MICROARRAY:
b1625
STRING:
511145.b1625
COLOMBOS: cnu


Product      
Name: H-NS- and StpA-binding protein
Synonym(s): Cnu, YdgT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.417
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
44 -> 44 D
8 -> 68 LKFRKISSLESLEKLYDHLNYTLTDDQELINMYRAADHRRAELVSGGRLFDLGQVPKSVWH

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
biological_process GO:0060566 - positive regulation of DNA-templated transcription, termination
GO:1900232 - negative regulation of single-species biofilm formation on inanimate substrate
Note(s): Note(s): ...[more].
Evidence: [IFC] Inferred by functional complementation
[IMP] Inferred from mutant phenotype
Reference(s): [1] Paytubi S., et al., 2004
[2] Pedro L., et al., 2011
[3] Saxena S., et al., 2011
[4] Srinivasan R., et al., 2013
External database links:  
DIP:
DIP-48011N
ECOCYC:
G6869-MONOMER
ECOLIWIKI:
b1625
INTERPRO:
IPR036666
INTERPRO:
IPR007985
MINT:
P64467
MODBASE:
P64467
PDB:
2JQT
PFAM:
PF05321
PRIDE:
P64467
PRODB:
PRO_000022307
REFSEQ:
NP_416142
SMR:
P64467
SWISSMODEL:
P64467
UNIPROT:
P64467


Operon      
Name: cnu         
Operon arrangement:
Transcription unit        Promoter
cnu


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cnup9 1704761 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter cnup10 1704812 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter cnup8 1704864 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter cnup7 1704873 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_1904 1705206 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1905 1705217 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1906 1705518 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1907 1705520 forward nd [RS-EPT-CBR] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paytubi S., Madrid C., Forns N., Nieto JM., Balsalobre C., Uhlin BE., Juarez A., 2004, YdgT, the Hha paralogue in Escherichia coli, forms heteromeric complexes with H-NS and StpA., Mol Microbiol 54(1):251-63

 [2] Pedro L., Banos RC., Aznar S., Madrid C., Balsalobre C., Juarez A., 2011, Antibiotics shaping bacterial genome: deletion of an IS91 flanked virulence determinant upon exposure to subinhibitory antibiotic concentrations., PLoS One 6(11):e27606

 [3] Saxena S., Gowrishankar J., 2011, Modulation of Rho-dependent transcription termination in Escherichia coli by the H-NS family of proteins., J Bacteriol 193(15):3832-41

 [4] Srinivasan R., Chandraprakash D., Krishnamurthi R., Singh P., Scolari VF., Krishna S., Seshasayee AS., 2013, Genomic analysis reveals epistatic silencing of "expensive" genes in Escherichia coli K-12., Mol Biosyst 9(8):2021-33

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB