RegulonDB RegulonDB 11.1: Gene Form

rsxB gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

rsxC rsxD rsxA rsxB ydgK terminator anti-terminator TSS_1909 TSS_1909 TSS_1908 TSS_1908 rsxAp rsxAp TSS_1907 TSS_1907 TSS_1906 TSS_1906

Name: rsxB    Texpresso search in the literature
Synonym(s): ECK1624, G6872, b1628, ydgM
Genome position(nucleotides): 1706348 --> 1706926
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: SoxR [2Fe-2S] reducing system protein RsxB
Synonym(s): RsxB, YdgM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.544
Isoelectric point: 4.38
Type Positions Sequence Comment
1 -> 26 MNAIWIAVAAVSLLGLAFGAILGYAS UniProt: Hydrophobic; Sequence Annotation Type: region of interest.
108 -> 137 MVAVIDENNCIGCTKCIQACPVDAIVGATR UniProt: 4Fe-4S ferredoxin-type 1.


Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0022900 - electron transport chain
Note(s): Note(s): ...[more].
Evidence: [COMP-HINF] Inferred by a human based on computational evidence
[EXP-IMP] Inferred from mutant phenotype
Reference(s): [1] Koo MS., et al., 2003
External database links:  

Name: ydgK-rsxABCDGE-nth         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1906 1705518 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1907 1705520 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1908 1706717 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1909 1708484 reverse nd [RS-EPT-CBR] [2]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Koo MS., Lee JH., Rah SY., Yeo WS., Lee JW., Lee KL., Koh YS., Kang SO., Roe JH., 2003, A reducing system of the superoxide sensor SoxR in Escherichia coli., EMBO J 22(11):2614-22

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
