RegulonDB RegulonDB 10.9: Gene Form
   

rsxD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: rsxD    Texpresso search in the literature
Synonym(s): ECK1626, G6874, b1630, ydgO
Genome position(nucleotides): 1709142 --> 1710200 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.6
External database links:  
ASAP:
ABE-0005457
ECHOBASE:
EB3695
ECOLIHUB:
rsxD
OU-MICROARRAY:
b1630
STRING:
511145.b1630
COLOMBOS: rsxD


Product      
Name: SoxR [2Fe-2S] reducing system protein RsxD
Synonym(s): RsxD, YdgO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 38.14
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
214 -> 234 ILAGAGWQWVNLAWLAGGVWL
301 -> 321 LIFGALAGLLVWLIRSFGGYP
322 -> 342 DGVAFAVLLANITVPLIDYYT
78 -> 109 ALLTGLLLAVSIPPLAPWWMVVLGTVFAVIIA
5 -> 348 IASSPYTHNQRQTSRIMLLVLLAAVPGIAAQLWFFGWGTLVQILLASVSALLAEALVLKLRKQSVAATLKDNSALLTGLLLAVSIPPLAPWWMVVLGTVFAVIIAKQLYGGLGQNPFNPAMIGYVVLLISFPVQMTSWLPPHEIAVNIPGFIDAIQVIFSGHTASGGDMNTLRLGIDGISQATPLDTFKTSVRAGHSVEQIMQYPIYSGILAGAGWQWVNLAWLAGGVWLLWQKAIRWHIPLSFLVTLALCAMLGWLFSPETLAAPQIHLLSGATMLGAFFILTDPVTASTTNRGRLIFGALAGLLVWLIRSFGGYPDGVAFAVLLANITVPLIDYYTRPRVYG

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0022900 - electron transport chain
GO:0055085 - transmembrane transport
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Koo MS., et al., 2003
[2] Serres MH., et al., 2001
External database links:  
ECOCYC:
G6874-MONOMER
ECOLIWIKI:
b1630
INTERPRO:
IPR011303
INTERPRO:
IPR004338
PANTHER:
PTHR30578
PANTHER:
PTHR30578:SF0
PFAM:
PF03116
PRIDE:
P76182
REFSEQ:
NP_416147
UNIPROT:
P76182


Operon      
Name: ydgK-rsxABCDGE-nth         
Operon arrangement:
Transcription unit        Promoter
ydgK-rsxABCDGE-nth
rsxABCDGE-nth


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1909 1708484 reverse nd [RS-EPT-CBR] [3]



RegulonDB