RegulonDB RegulonDB 10.9: Gene Form
   

pdxY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tyrS pdxY gstA anti-anti-terminator anti-terminator terminator TSS_1913 TSS_1913

Gene      
Name: pdxY    Texpresso search in the literature
Synonym(s): ECK1632, G6879, b1636, ydgS
Genome position(nucleotides): 1715026 <-- 1715889 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.01
External database links:  
ASAP:
ABE-0005475
ECHOBASE:
EB3699
ECOLIHUB:
pdxY
OU-MICROARRAY:
b1636
STRING:
511145.b1636
COLOMBOS: pdxY


Product      
Name: pyridoxal kinase 2
Synonym(s): PdxY, YdgS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.322
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
45 -> 46 TQ
209 -> 212 RPLV
67 -> 256 IAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFCDPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCEHAVNNVEEAVLAARELIAQGPQIVLVKHLARAGYSRDRFEMLLVTADEAWHISRPLVDFGMRQPVGVGDVTSGLLLVKLLQGATLQEALEHVTAAVYEIMV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.27 - pyridoxal 5'-phosphate salvage
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008478 - pyridoxal kinase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0009443 - pyridoxal 5'-phosphate salvage
GO:0042819 - vitamin B6 biosynthetic process
GO:0016310 - phosphorylation
GO:0042817 - pyridoxal metabolic process
External database links:  
ECOCYC:
PDXY-MONOMER
ECOLIWIKI:
b1636
INTERPRO:
IPR023685
INTERPRO:
IPR029056
INTERPRO:
IPR004625
INTERPRO:
IPR013749
MODBASE:
P77150
PANTHER:
PTHR10534
PDB:
1VI9
PDB:
1TD2
PFAM:
PF08543
PRIDE:
P77150
PRODB:
PRO_000023507
REFSEQ:
NP_416153
SMR:
P77150
UNIPROT:
P77150


Operon      
Name: pdxH-tyrS-pdxY         
Operon arrangement:
Transcription unit        Promoter
tyrS-pdxY
tyrS-pdxY
pdxH-tyrS-pdxY
pdxY


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1913 1716884 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB