RegulonDB RegulonDB 10.9: Gene Form
   

slyB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: slyB    Texpresso search in the literature
Synonym(s): ECK1637, G6881, b1641
Genome position(nucleotides): 1719876 --> 1720343 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.28
External database links:  
ASAP:
ABE-0005493
ECHOBASE:
EB3185
ECOLIHUB:
slyB
OU-MICROARRAY:
b1641
STRING:
511145.b1641
COLOMBOS: slyB


Product      
Name: outer membrane lipoprotein SlyB
Synonym(s): SlyB
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 15.602
Isoelectric point: 9.794
Motif(s):
 
Type Positions Sequence
62 -> 102 IGAIGGAVLGGFLGNTVGGGTGRSLATAAGAVAGGVAGQGV
18 -> 155 CVNNDTLSGDVYTASEAKQVQNVSYGTIVNVRPVQIQGGDDSNVIGAIGGAVLGGFLGNTVGGGTGRSLATAAGAVAGGVAGQGVQSAMNKTQGVELEIRKDDGNTIMVVQKQGNTRFSPGQRVVLASNGSQVTVSPR
1 -> 17 MIKRVLVVSMVGLSLVG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Maddalo G., et al., 2011
External database links:  
ECOCYC:
G6881-MONOMER
ECOLIWIKI:
b1641
INTERPRO:
IPR008816
PFAM:
PF05433
PRIDE:
P0A905
PRODB:
PRO_000023958
PROSITE:
PS51257
REFSEQ:
YP_025304
SMR:
P0A905
UNIPROT:
P0A905


Operon      
Name: slyB         
Operon arrangement:
Transcription unit        Promoter
slyB
slyB


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP
Repressed by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1917 (cluster) 1719631 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter anmKp9 1719673 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1918 (cluster) 1719751 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1919 1719770 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1921 1719780 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1922 1719799 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1923 1719807 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1924 1719829 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1925 1719831 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1926 1720091 forward nd [RS-EPT-CBR] [2]



RegulonDB