RegulonDB RegulonDB 10.9: Gene Form
   

mepH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mepH sodB grxD CRP NsrR IHF NsrR NsrR FnrS terminator anti-terminator TSS_1943 TSS_1943 TSS_1942 (cluster) TSS_1942 (cluster) TSS_1941 TSS_1941 TSS_1940 TSS_1940 TSS_1939 TSS_1939 TSS_1938 (cluster) TSS_1938 (cluster) TSS_1937 TSS_1937 sodBp sodBp mepHp mepHp TSS_1936 TSS_1936 grxD grxD TSS_1935 TSS_1935 TSS_1934 (cluster) TSS_1934 (cluster) TSS_1933 TSS_1933 TSS_1932 (cluster) TSS_1932 (cluster)

Gene      
Name: mepH    Texpresso search in the literature
Synonym(s): ECK1651, G6892, b1655, ydhO
Genome position(nucleotides): 1734435 --> 1735250 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.79
External database links:  
ASAP:
ABE-0005533
ECHOBASE:
EB3707
ECOLIHUB:
ydhO
OU-MICROARRAY:
b1655
STRING:
511145.b1655
COLOMBOS: mepH


Product      
Name: peptidoglycan DD-endopeptidase MepH
Synonym(s): MepH, YdhO
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 29.917
Isoelectric point: 11.169
Motif(s):
 
Type Positions Sequence
153 -> 263 GKPYRWGGSSPRTGFDCSGLVYYAYKDLVKIRIPRTANEMYHLRDAAPIERSELKNGDLVFFRTQGRGTADHVGVYVGNGKFIQSPRTGQEIQITSLSEDYWQRHYVGARR
1 -> 27 MARINRISITLCALLFTTLPLTPMAHA
28 -> 271 SKQARESSATTHITKKADKKKSTATTKKTQKTAKKAASKSTTKSKTASSVKKSSITASKNAKTRSKHAVNKTASASFTEKCTKRKGYKSHCVKVKNAASGTLADAHKAKVQKATKVAMNKLMQQIGKPYRWGGSSPRTGFDCSGLVYYAYKDLVKIRIPRTANEMYHLRDAAPIERSELKNGDLVFFRTQGRGTADHVGVYVGNGKFIQSPRTGQEIQITSLSEDYWQRHYVGARRVMTPKTLR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0008234 - cysteine-type peptidase activity
GO:0004175 - endopeptidase activity
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0006508 - proteolysis
GO:0045227 - capsule polysaccharide biosynthetic process
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6892-MONOMER
ECOLIWIKI:
b1655
INTERPRO:
IPR038765
INTERPRO:
IPR000064
PFAM:
PF00877
PRIDE:
P76190
REFSEQ:
NP_416172
SMR:
P76190
UNIPROT:
P76190


Operon      
Name: mepH         
Operon arrangement:
Transcription unit        Promoter
mepH


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1932 (cluster) 1733911 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1933 1734118 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1934 (cluster) 1734136 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1935 1734160 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1936 1734189 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1937 1735325 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1938 (cluster) 1735338 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1939 1735345 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1940 1735349 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1941 1735351 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1942 (cluster) 1735355 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1943 1735359 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB