RegulonDB RegulonDB 10.9: Gene Form
   

ydhR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhS ydhR valW terminator anti-terminator anti-anti-terminator terminator ydhSp5 ydhSp5 TSS_1957 TSS_1957 ydhSp6 ydhSp6 ydhSp3 ydhSp3 TSS_1956 TSS_1956

Gene      
Name: ydhR    Texpresso search in the literature
Synonym(s): ECK1663, G6895, b1667
Genome position(nucleotides): 1746700 --> 1747005 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.77
External database links:  
ASAP:
ABE-0005572
ECHOBASE:
EB3710
ECOLIHUB:
ydhR
OU-MICROARRAY:
b1667
STRING:
511145.b1667
COLOMBOS: ydhR


Product      
Name: putative monooxygenase YdhR
Synonym(s): YdhR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.288
Isoelectric point: 4.838
Motif(s):
 
Type Positions Sequence
4 -> 98 LLQLHFAFNGPFGDAMAEQLKPLAESINQEPGFLWKVWTESEKNHEAGGIYLFTDEKSALAYLEKHTARLKNLGVEEVVAKVFDVNEPLSQINQA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48270N
ECOCYC:
G6895-MONOMER
ECOLIWIKI:
b1667
INTERPRO:
IPR014910
INTERPRO:
IPR011008
PANTHER:
PTHR39169
PDB:
2ASY
PDB:
2HIQ
PDB:
1WD6
PFAM:
PF08803
PRIDE:
P0ACX3
REFSEQ:
NP_416182
SMR:
P0ACX3
UNIPROT:
P0ACX3


Operon      
Name: ydhR         
Operon arrangement:
Transcription unit        Promoter
ydhR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1956 1746673 forward nd [RS-EPT-CBR] [1]
  promoter ydhSp3 1747068 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydhSp6 1747082 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1957 1747091 forward nd [RS-EPT-CBR] [1]
  promoter ydhSp5 1747113 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB