RegulonDB RegulonDB 10.9: Gene Form
   

ydhU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhT ydhU ydhX ydhW ydhTp1 ydhTp1

Gene      
Name: ydhU    Texpresso search in the literature
Synonym(s): ECK1666, G6898, b1670
Genome position(nucleotides): 1749563 <-- 1750348 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.24
External database links:  
ASAP:
ABE-0005579
ECHOBASE:
EB3713
ECOLIHUB:
ydhU
OU-MICROARRAY:
b1670
STRING:
511145.b1670
COLOMBOS: ydhU


Product      
Name: putative cytochrome YdhU
Synonym(s): YdhU
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 29.583
Isoelectric point: 9.487
Motif(s):
 
Type Positions Sequence
108 -> 128 VAVHEVCGFLLLACWLGFVLI
224 -> 244 FALAFISLFFIFGHLYLCTTG
182 -> 202 VAYVGVMYGLLPLLLLTGLLC
69 -> 257 YSKAVRLWHWSNALLFVLLLASGLINHFAMVGATAVKSLVAVHEVCGFLLLACWLGFVLINAVGDNGHHYRIRRQGWLERAAKQTRFYLFGIMQGEEHPFPATTQSKFNPLQQVAYVGVMYGLLPLLLLTGLLCLYPQAVGDVFPGVRYWLLQTHFALAFISLFFIFGHLYLCTTGRTPHETFKSMVDG
25 -> 45 FWPVWLIIAGVLLVGMWLVLG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0020037 - heme binding
biological_process GO:0022904 - respiratory electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Awad A Al Ibrahim N., et al., 2017
External database links:  
DIP:
DIP-11740N
ECOCYC:
G6898-MONOMER
ECOLIWIKI:
b1670
INTERPRO:
IPR011577
INTERPRO:
IPR016174
MODBASE:
P77409
PFAM:
PF01292
PRIDE:
P77409
REFSEQ:
NP_416185
UNIPROT:
P77409


Operon      
Name: ydhYVWXUT         
Operon arrangement:
Transcription unit        Promoter
ydhYVWXUT
ydhXUT
ydhYVW


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydhTp1 1749569 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Awad A Al Ibrahim N., Green J., 2017, Regulation of the Escherichia coli ydhY-T operon in the presence of alternative electron acceptors., Microbiology 163(4):584-594

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB