RegulonDB RegulonDB 11.1: Gene Form
   

fumD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhY fumD ynhH Cra NarL FNR NarL NarP NarL NarP NarL TSS_1970 TSS_1970 TSS_1969 TSS_1969 TSS_1968 TSS_1968 pykFp5 pykFp5 pykFp1 pykFp1 TSS_1967 TSS_1967 TSS_1966 TSS_1966 TSS_1965 (cluster) TSS_1965 (cluster) pykFp3 pykFp3 pykFp4 pykFp4 pykFp2 pykFp2 TSS_1963 TSS_1963 TSS_1962 TSS_1962 TSS_1961 TSS_1961 TSS_1960 (cluster) TSS_1960 (cluster) pykFp pykFp fumDp6 fumDp6 fumDp5 fumDp5 TSS_1959 (cluster) TSS_1959 (cluster) ydhYp ydhYp

Gene      
Name: fumD    Texpresso search in the literature
Synonym(s): ECK1671, G6903, b1675, ydhZ
Genome position(nucleotides): 1754932 <-- 1755141
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.67
External database links:  
ASAP:
ABE-0005591
ECHOBASE:
EB3718
ECOLIHUB:
ydhZ
OU-MICROARRAY:
b1675
STRING:
511145.b1675
COLOMBOS: fumD


Product      
Name: fumarase D
Synonym(s): FumD, YdhZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.907
Isoelectric point: 9.911
Motif(s):
 
Type Positions Sequence Comment
1 -> 67 MGNRTKEDELYREMCRVVGKVVLEMRDLGQEPKHIVIAGVLRTALANKRIQRSELEKQAMETVINAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0004333 - fumarate hydratase activity
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P0ACX5
ECOCYC:
G6903-MONOMER
ECOLIWIKI:
b1675
INTERPRO:
IPR024493
PFAM:
PF10965
PRIDE:
P0ACX5
REFSEQ:
NP_416190
SMR:
P0ACX5
UNIPROT:
P0ACX5


Operon      
Name: fumD         
Operon arrangement:
Transcription unit        Promoter
fumD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1959 (cluster) 1755165 reverse nd [RS-EPT-CBR] [1]
  promoter fumDp5 1755167 reverse nd [COMP-AINF] [2]
  promoter fumDp6 1755209 reverse nd [COMP-AINF] [2]
  promoter TSS_1960 (cluster) 1755468 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1961 1755475 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1962 1755528 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1963 1755559 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1965 (cluster) 1755619 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1966 1755627 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1967 1755661 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1968 1755668 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1969 1755671 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1970 1755674 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [COMP-AINF] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB