RegulonDB RegulonDB 10.9: Gene Form
   

sufD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sufB sufD sufS sufC sufE sufEp3 sufEp3 ynhGp4 ynhGp4 ynhGp7 ynhGp7

Gene      
Name: sufD    Texpresso search in the literature
Synonym(s): ECK1677, G6907, b1681, ynhC
Genome position(nucleotides): 1760520 <-- 1761791 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.3
External database links:  
ASAP:
ABE-0005617
ECHOBASE:
EB3721
ECOLIHUB:
sufD
OU-MICROARRAY:
b1681
STRING:
511145.b1681
COLOMBOS: sufD


Product      
Name: Fe-S cluster scaffold complex subunit SufD
Synonym(s): SufD, SufD component of SufBCD Fe-S cluster scaffold complex, YnhC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.823
Isoelectric point: 6.854
Motif(s):
 
Type Positions Sequence
170 -> 393 HYRHHLDLAEGAEATVIEHFVSLNDARHFTGARFTINVAANAHLQHIKLAFENPLSHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQDAQQMIIYAF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:1990229 - iron-sulfur cluster assembly complex
molecular_function GO:0005515 - protein binding
biological_process GO:0006979 - response to oxidative stress
GO:0016226 - iron-sulfur cluster assembly
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10940N
ECOCYC:
G6907-MONOMER
ECOLIWIKI:
b1681
INTERPRO:
IPR000825
INTERPRO:
IPR037284
INTERPRO:
IPR011542
MINT:
P77689
MODBASE:
P77689
PANTHER:
PTHR43575
PDB:
5AWG
PDB:
5AWF
PDB:
2ZU0
PDB:
1VH4
PFAM:
PF01458
PRIDE:
P77689
PRODB:
PRO_000024008
REFSEQ:
NP_416196
SMR:
P77689
UNIPROT:
P77689


Operon      
Name: sufABCDSE         
Operon arrangement:
Transcription unit        Promoter
sufABCDSE


Transcriptional Regulation      
Display Regulation             
Activated by: IscR, IHF, OxyR
Repressed by: NsrR, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynhGp7 1758944 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynhGp4 1758945 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter sufEp3 1759481 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB