RegulonDB RegulonDB 10.9: Gene Form
   

sufB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sufB sufC sufA sufD

Gene      
Name: sufB    Texpresso search in the literature
Synonym(s): ECK1679, G6909, b1683, ynhE
Genome position(nucleotides): 1762522 <-- 1764009 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.55
External database links:  
ASAP:
ABE-0005621
ECHOBASE:
EB3723
ECOLIHUB:
sufB
OU-MICROARRAY:
b1683
STRING:
511145.b1683
COLOMBOS: sufB


Product      
Name: Fe-S cluster scaffold complex subunit SufB
Synonym(s): SufB, SufB component of SufBCD Fe-S cluster scaffold complex, YnhE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 54.745
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
234 -> 466 QFERTILVADEDSYVSYIEGCSAPVRDSYQLHAAVVEVIIHKNAEVKYSTVQNWFPGDNNTGGILNFVTKRALCEGENSKMSWTQSETGSAITWKYPSCILRGDNSIGEFYSVALTSGHQQADTGTKMIHIGKNTKSTIISKGISAGHSQNSYRGLVKIMPTATNARNFTQCDSMLIGANCGAHTFPYVECRNNSAQLEHEATTSRIGEDQLFYCLQRGISEEDAISMIVNGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:1990229 - iron-sulfur cluster assembly complex
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
biological_process GO:0016226 - iron-sulfur cluster assembly
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10938N
DISPROT:
DP01920
ECOCYC:
G6909-MONOMER
ECOLIWIKI:
b1683
INTERPRO:
IPR000825
INTERPRO:
IPR010231
INTERPRO:
IPR037284
MODBASE:
P77522
PDB:
5AWG
PDB:
5AWF
PFAM:
PF01458
PRIDE:
P77522
PRODB:
PRO_000024007
REFSEQ:
NP_416198
SMR:
P77522
UNIPROT:
P77522


Operon      
Name: sufABCDSE         
Operon arrangement:
Transcription unit        Promoter
sufABCDSE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, IscR, OxyR
Repressed by: NsrR, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB