RegulonDB RegulonDB 10.9: Gene Form
   

ydiO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiF ydiO ydiP

Gene      
Name: ydiO    Texpresso search in the literature
Synonym(s): ECK1693, G6918, b1695
Genome position(nucleotides): 1777196 --> 1778347 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.91
External database links:  
ASAP:
ABE-0005658
ECHOBASE:
EB3731
ECOLIHUB:
ydiO
MIM:
201470
OU-MICROARRAY:
b1695
STRING:
511145.b1695
COLOMBOS: ydiO


Product      
Name: putative acyl-CoA dehydrogenase YdiO
Synonym(s): YdiO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.002
Isoelectric point: 5.067
Motif(s):
 
Type Positions Sequence
121 -> 216 ALALTEPGAGSDNNSATTTYTRKNGKVYINGQKTFITGAKEYPYMLVLARDPQPKDPKKAFTLWWVDSSKPGIKINPLHKIGWHMLSTCEVYLDNV
6 -> 107 TEEQELLLASIRELITTNFPEEYFRTCDQNGTYPREFMRALADNGISMLGVPEEFGGIPADYVTQMLALMEVSKCGAPAFLITNGQCIHSMRRFGSAEQLRK
228 -> 376 GMGFLNVMYNFEMERLINAARSTGFAECAFEDAARYANQRIAFGKPIGHNQMIQEKLALMAIKIDNMRNMVLKVAWQADQHQSLRTSAALAKLYCARTAMEVIDDAIQIMGGLGYTDEARVSRFWRDVRCERIGGGTDEIMIYVAGRQI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  1 - metabolism --> 1.4 - energy production/transport
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016627 - oxidoreductase activity, acting on the CH-CH group of donors
GO:0050660 - flavin adenine dinucleotide binding
GO:0003995 - acyl-CoA dehydrogenase activity
biological_process GO:0055114 - oxidation-reduction process
GO:0071271 - 1-butanol biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Campbell JW., et al., 2003
[2] Gulevich AY., et al., 2016
[3] Gulevich AY., et al., 2012
External database links:  
ECOCYC:
G6918-MONOMER
ECOLIWIKI:
b1695
INTERPRO:
IPR009075
INTERPRO:
IPR009100
INTERPRO:
IPR006091
INTERPRO:
IPR006089
INTERPRO:
IPR013786
INTERPRO:
IPR037069
INTERPRO:
IPR036250
MODBASE:
P0A9U8
PFAM:
PF02770
PFAM:
PF02771
PFAM:
PF00441
PRIDE:
P0A9U8
PROSITE:
PS00072
PROSITE:
PS00073
REFSEQ:
NP_416210
SMR:
P0A9U8
UNIPROT:
P0A9U8


Operon      
Name: ydiFO         
Operon arrangement:
Transcription unit        Promoter
ydiFO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Campbell JW., Morgan-Kiss RM., E Cronan J., 2003, A new Escherichia coli metabolic competency: growth on fatty acids by a novel anaerobic beta-oxidation pathway., Mol Microbiol 47(3):793-805

 [2] Gulevich AY., Skorokhodova AY., Debabov VG., 2016, [Escherichia coli ydiO and ydiQRST genes encode components of acyl-CoA dehydrogenase complex of anaerobic fatty acid β-oxidation pathway]., Genetika 52(10):1210-4

 [3] Gulevich AY., Skorokhodova AY., Sukhozhenko AV., Shakulov RS., Debabov VG., 2012, Metabolic engineering of Escherichia coli for 1-butanol biosynthesis through the inverted aerobic fatty acid β-oxidation pathway., Biotechnol Lett 34(3):463-9


RegulonDB