RegulonDB RegulonDB 10.9: Gene Form
   

ydiQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiR ydiP ydiQ anti-terminator terminator ydiPp ydiPp

Gene      
Name: ydiQ    Texpresso search in the literature
Synonym(s): ECK1695, G6920, b1697
Genome position(nucleotides): 1779617 --> 1780381 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.37
External database links:  
ASAP:
ABE-0005666
ECHOBASE:
EB3733
ECOLIHUB:
ydiQ
OU-MICROARRAY:
b1697
STRING:
511145.b1697
COLOMBOS: ydiQ


Product      
Name: putative electron transfer flavoprotein subunit YdiQ
Synonym(s): YdiQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 27.47
Isoelectric point: 4.279
Motif(s):
 
Type Positions Sequence
28 -> 206 NADAKISQFDLNAIEAASQLATDDDEIAALTVGGSLLQNSKVRKDVLSRGPHSLYLVQDAQLEHALPLDTAKALAAAIEKIGFDLLIFGEGSGDLYAQQVGLLVGEILQLPVINAVSAIQRQGNTLVIERTLEDDVEVIELSVPAVLCVTSDINVPRIPSMKAILGAGKKPVNQWQASD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
molecular_function GO:0009055 - electron transfer activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Campbell JW., et al., 2003
External database links:  
ECOCYC:
G6920-MONOMER
ECOLIWIKI:
b1697
INTERPRO:
IPR000049
INTERPRO:
IPR012255
INTERPRO:
IPR014729
INTERPRO:
IPR014730
INTERPRO:
IPR033948
MODBASE:
P76201
PANTHER:
PTHR21294
PFAM:
PF01012
PRIDE:
P76201
PROSITE:
PS01065
REFSEQ:
NP_416212
SMART:
SM00893
SMR:
P76201
UNIPROT:
P76201


Operon      
Name: ydiQRST-fadK         
Operon arrangement:
Transcription unit        Promoter
ydiQRST-fadK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Campbell JW., Morgan-Kiss RM., E Cronan J., 2003, A new Escherichia coli metabolic competency: growth on fatty acids by a novel anaerobic beta-oxidation pathway., Mol Microbiol 47(3):793-805


RegulonDB