RegulonDB RegulonDB 10.9: Gene Form
   

ydiS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadK ydiS ydiR ydiT terminator

Gene      
Name: ydiS    Texpresso search in the literature
Synonym(s): ECK1697, G6922, b1699
Genome position(nucleotides): 1781395 --> 1782684 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.65
External database links:  
ASAP:
ABE-0005671
ECHOBASE:
EB3735
ECOLIHUB:
ydiS
MIM:
231680
OU-MICROARRAY:
b1699
STRING:
511145.b1699
COLOMBOS: ydiS


Product      
Name: putative electron transfer flavoprotein-quinone oxidoreductase YdiS
Synonym(s): YdiS, putative oxidoreductase with FAD/NAD(P)-binding domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.923
Isoelectric point: 5.817
Motif(s):
 
Type Positions Sequence
8 -> 22 AIVVGAGVAGSVAAL
6 -> 185 FDAIVVGAGVAGSVAALVMARAGLDVLVIERGDSAGCKNMTGGRLYAHTLEAIIPGFAVSAPVERKVTREKISFLTEESAVTLDFHREQPDVPQHASYTVLRNRLDPWLMEQAEQAGAQFIPGVRVDALVREGNKVTGVQAGDDILEANVVILADGVNSMLGRSLGMVPASDPHHYAVGV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0071949 - FAD binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Campbell JW., et al., 2003
[2] Li H., et al., 2018
[3] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G6922-MONOMER
ECOLIWIKI:
b1699
INTERPRO:
IPR039651
INTERPRO:
IPR036188
INTERPRO:
IPR002938
MODBASE:
P77337
PANTHER:
PTHR43624
PFAM:
PF01494
PRIDE:
P77337
REFSEQ:
NP_416214
SMR:
P77337
UNIPROT:
P77337


Operon      
Name: ydiQRST-fadK         
Operon arrangement:
Transcription unit        Promoter
ydiQRST-fadK


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Campbell JW., Morgan-Kiss RM., E Cronan J., 2003, A new Escherichia coli metabolic competency: growth on fatty acids by a novel anaerobic beta-oxidation pathway., Mol Microbiol 47(3):793-805

 [2] Li H., Mao S., Chen H., Zhu L., Liu W., Wang X., Yin Y., 2018, To Construct an Engineered ( S)-Equol Resistant E. coli for in Vitro ( S)-Equol Production., Front Microbiol 9:1182

 [3] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056


RegulonDB