RegulonDB RegulonDB 10.9: Gene Form
   

ydjM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tcyP hxpB ydjM LexA LexA terminator anti-terminator terminator TSS_2045 (cluster) TSS_2045 (cluster) tcyPp tcyPp ydjMp ydjMp

Gene      
Name: ydjM    Texpresso search in the literature
Synonym(s): ECK1726, G6933, b1728
Genome position(nucleotides): 1810211 --> 1810801 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.27
External database links:  
ASAP:
ABE-0005768
ECHOBASE:
EB3745
ECOLIHUB:
ydjM
OU-MICROARRAY:
b1728
STRING:
511145.b1728
COLOMBOS: ydjM


Product      
Name: inner membrane protein YdjM
Synonym(s): YdjM, putative inner membrane protein regulated by LexA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 22.35
Isoelectric point: 9.341
Motif(s):
 
Type Positions Sequence
78 -> 98 LLAVFALLATFYLKVPEGWFI
150 -> 170 FICMALFVWSVWMPHSLPENS
1 -> 160 MTAEGHLLFSIACAVFAKNAELTPVLAQGDWWHIVPSAILTCLLPDIDHPKSFLGQRLKWISKPIARAFGHRGFTHSLLAVFALLATFYLKVPEGWFIPADALQGMVLGYLSHILADMLTPAGVPLLWPCRWRFRLPILVPQKGNQLERFICMALFVWSV
24 -> 44 PVLAQGDWWHIVPSAILTCLL
107 -> 127 VLGYLSHILADMLTPAGVPLL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6933-MONOMER
ECOLIWIKI:
b1728
INTERPRO:
IPR007404
INTERPRO:
IPR016956
PFAM:
PF04307
PRIDE:
P64481
REFSEQ:
NP_416242
UNIPROT:
P64481


Operon      
Name: ydjM         
Operon arrangement:
Transcription unit        Promoter
ydjM


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2045 (cluster) 1811112 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB