RegulonDB RegulonDB 10.9: Gene Form
   

cho gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cho ves spy nadE spy3\' LexA vesp vesp chop chop

Gene      
Name: cho    Texpresso search in the literature
Synonym(s): ECK1739, G6937, b1741, ydjQ
Genome position(nucleotides): 1823515 --> 1824402 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.58
External database links:  
ASAP:
ABE-0005807
ECHOBASE:
EB3749
ECOLIHUB:
cho
OU-MICROARRAY:
b1741
STRING:
511145.b1741
COLOMBOS: cho


Product      
Name: excinuclease Cho
Synonym(s): Cho, YdjQ, endonuclease of nucleotide excision repair, sosD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.739
Isoelectric point: 8.946
Motif(s):
 
Type Positions Sequence
33 -> 108 TRPGVYLFHGESDTMPLYIGKSVNIRSRVLSHLRTPDEAAMLRQSRRISWICTAGEIGALLLEARLIKEQQPLFNK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.6 - protection
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009380 - excinuclease repair complex
molecular_function GO:0004518 - nuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0004520 - endodeoxyribonuclease activity
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0033683 - nucleotide-excision repair, DNA incision
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Moolenaar GF., et al., 2002
External database links:  
DIP:
DIP-28067N
ECOCYC:
G6937-MONOMER
ECOLIWIKI:
b1741
INTERPRO:
IPR035901
INTERPRO:
IPR000305
MODBASE:
P76213
PRIDE:
P76213
PRODB:
PRO_000022283
PROSITE:
PS50164
REFSEQ:
NP_416255
SMART:
SM00465
UNIPROT:
P76213


Operon      
Name: cho         
Operon arrangement:
Transcription unit        Promoter
cho


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2052 1822732 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Moolenaar GF., van Rossum-Fikkert S., van Kesteren M., Goosen N., 2002, Cho, a second endonuclease involved in Escherichia coli nucleotide excision repair., Proc Natl Acad Sci U S A 99(3):1467-72

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB