RegulonDB RegulonDB 10.9: Gene Form
   

spy gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

astE ves spy cho astB BaeR BaeR CpxR TSS_2054 TSS_2054 spyp spyp TSS_2053 TSS_2053 vesp vesp

Gene      
Name: spy    Texpresso search in the literature
Synonym(s): ECK1741, G6939, b1743
Genome position(nucleotides): 1825140 <-- 1825625 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.82
External database links:  
ASAP:
ABE-0005812
ECHOBASE:
EB3263
ECOLIHUB:
spy
OU-MICROARRAY:
b1743
STRING:
511145.b1743
COLOMBOS: spy


Product      
Name: ATP-independent periplasmic chaperone
Synonym(s): Spy
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 18.199
Isoelectric point: 10.423
Motif(s):
 
Type Positions Sequence
72 -> 72 Q
138 -> 138 F
38 -> 38 M
46 -> 141 PHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNAN
57 -> 61 LTDAQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0051082 - unfolded protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0014070 - response to organic cyclic compound
GO:0061077 - chaperone-mediated protein folding
GO:1990507 - ATP-independent chaperone mediated protein folding
External database links:  
DIP:
DIP-10914N
ECOCYC:
G6939-MONOMER
ECOLIWIKI:
b1743
INTERPRO:
IPR012899
PDB:
6OWX
PDB:
6OWY
PDB:
6OWZ
PDB:
6BIE
PDB:
5WO3
PDB:
5WO2
PDB:
5WO1
PDB:
5WNW
PFAM:
PF07813
PRIDE:
P77754
PRODB:
PRO_000023981
REFSEQ:
NP_416257
SMR:
P77754
UNIPROT:
P77754


Operon      
Name: spy         
Operon arrangement:
Transcription unit        Promoter
spy


Transcriptional Regulation      
Display Regulation             
Activated by: BaeR, CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2053 1825686 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2054 1825737 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB