RegulonDB RegulonDB 10.9: Gene Form
   

ydjY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydjX ydjZ ydjY TSS_2062 (cluster) TSS_2062 (cluster) TSS_2061 TSS_2061 TSS_2060 TSS_2060 TSS_2059 TSS_2059 TSS_2058 TSS_2058 TSS_2057 TSS_2057

Gene      
Name: ydjY    Texpresso search in the literature
Synonym(s): ECK1749, G6946, b1751
Genome position(nucleotides): 1834116 --> 1834793 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.38
External database links:  
ASAP:
ABE-0005834
ECHOBASE:
EB3757
ECOLIHUB:
ydjY
OU-MICROARRAY:
b1751
STRING:
511145.b1751
COLOMBOS: ydjY


Product      
Name: 4Fe-4S ferredoxin-type domain-containing protein YdjY
Synonym(s): YdjY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.125
Isoelectric point: 6.664
Motif(s):
 
Type Positions Sequence
161 -> 190 GNLTAAEEKKTGCLVCLDSCPVGIVSNATY
23 -> 225 GLSGCDQQENAAAKVEYDGLSNSQPLRVDANNHTVTMLVQINGRFLTDDTRHGIVFKDGSNGHKSLFMGYATPKAFYEALKEAGGTPGENMTMDNKETTHVTGSKLDISVNWQGAAKAYSFDEVIVDSNGKKLDMRFGGNLTAAEEKKTGCLVCLDSCPVGIVSNATYTYGAVEKRGEVKFKGNASVLPADNTLATVTFKIAE
1 -> 22 MLQHYSVSWKKGLAALCLLAVA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6946-MONOMER
ECOLIWIKI:
b1751
INTERPRO:
IPR017896
PRIDE:
P76220
PROSITE:
PS51379
REFSEQ:
NP_416265
SMR:
P76220
UNIPROT:
P76220


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
ydjXYZ-ynjABCD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2057 1833569 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2058 1833986 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2059 1834126 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2060 1834129 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2061 1835147 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2062 (cluster) 1835149 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB