RegulonDB RegulonDB 10.9: Gene Form
   

ynjA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynjB ydjZ ydjY ynjA ynjC TSS_2062 (cluster) TSS_2062 (cluster) TSS_2061 TSS_2061 TSS_2060 TSS_2060 TSS_2059 TSS_2059

Gene      
Name: ynjA    Texpresso search in the literature
Synonym(s): ECK1751, G6948, b1753
Genome position(nucleotides): 1835515 --> 1836063 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.28
External database links:  
ASAP:
ABE-0005839
ECHOBASE:
EB3759
ECOLIHUB:
ynjA
OU-MICROARRAY:
b1753
STRING:
511145.b1753
COLOMBOS: ynjA


Product      
Name: AhpD-like domain-containing protein YnjA
Synonym(s): YnjA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 20.533
Isoelectric point: 8.653
Motif(s):
 
Type Positions Sequence
52 -> 122 ERKRSPLDPVVRSLVSARIAQMCLCEFCVDITSMKVAERTGSSDKLLAVADWRQSPLFSDEERLALEYAEA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0051920 - peroxiredoxin activity
biological_process GO:0055114 - oxidation-reduction process
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6948-MONOMER
ECOLIWIKI:
b1753
INTERPRO:
IPR003779
INTERPRO:
IPR029032
MODBASE:
P76222
PFAM:
PF02627
PRIDE:
P76222
REFSEQ:
NP_416267
SMR:
P76222
UNIPROT:
P76222


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
ydjXYZ-ynjABCD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2059 1834126 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2060 1834129 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2061 1835147 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2062 (cluster) 1835149 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB