RegulonDB RegulonDB 10.9: Gene Form
   

ynjH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gdhA ynjF nudG ynjH Nac Nac Nac CRP ArgP Nac ArgP terminator TSS_2070 TSS_2070 TSS_2069 TSS_2069 TSS_2068 TSS_2068 TSS_2067 TSS_2067 TSS_2066 TSS_2066 TSS_2065 TSS_2065 gdhAp1 gdhAp1 ynjHp2 ynjHp2 ynjHp ynjHp ynjFp6 ynjFp6 nudGp3 nudGp3 ynjFp ynjFp

Gene      
Name: ynjH    Texpresso search in the literature
Synonym(s): ECK1758, G6955, b1760
Genome position(nucleotides): 1841863 <-- 1842135 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.55
External database links:  
ASAP:
ABE-0005858
ECHOBASE:
EB3766
ECOLIHUB:
ynjH
OU-MICROARRAY:
b1760
STRING:
511145.b1760
COLOMBOS: ynjH


Product      
Name: DUF1496 domain-containing protein YnjH
Synonym(s): YnjH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 9.947
Isoelectric point: 7.132
Motif(s):
 
Type Positions Sequence
19 -> 90 NPHYRPDVEVNVPPEVFSSGGQSAQPCTQCCVYQDQNYSEGAVIKAEGILLQCQRDDKTLSTNPLVWRRVKP
34 -> 89 VFSSGGQSAQPCTQCCVYQDQNYSEGAVIKAEGILLQCQRDDKTLSTNPLVWRRVK
1 -> 18 MSRALFAVVLAFPLIALA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12784N
ECOCYC:
G6955-MONOMER
ECOLIWIKI:
b1760
INTERPRO:
IPR009971
PFAM:
PF07383
PRIDE:
P76227
REFSEQ:
NP_416274
UNIPROT:
P76227


Operon      
Name: ynjH         
Operon arrangement:
Transcription unit        Promoter
ynjH
ynjH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter nudGp3 1841438 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynjFp6 1841611 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2065 1842321 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2066 1842327 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2067 1842332 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2068 1842691 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2069 1843057 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2070 1843063 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB