RegulonDB RegulonDB 10.9: Gene Form
   

ydjG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydjG ydjH ydjF ydjFp1 ydjFp1 ydjFp7 ydjFp7

Gene      
Name: ydjG    Texpresso search in the literature
Synonym(s): ECK1769, G6958, b1771
Genome position(nucleotides): 1854991 <-- 1855971 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.81
External database links:  
ASAP:
ABE-0005901
ECHOBASE:
EB3256
ECOLIHUB:
ydjG
OU-MICROARRAY:
b1771
STRING:
511145.b1771
COLOMBOS: ydjG


Product      
Name: NADH-dependent methylglyoxal reductase
Synonym(s): YdjG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.329
Isoelectric point: 4.876
Motif(s):
 
Type Positions Sequence
16 -> 320 MGLGTWAIGGGPAWNGDLDRQICIDTILEAHRCGINLIDTAPGYNFGNSEVIVGQALKKLPREQVVVETKCGIVWERKGSLFNKVGDRQLYKNLSPESIREEVAASLQRLGIDYIDIYMTHWQSVPPFFTPIAETVAVLNELKSEGKIRAIGAANVDADHIREYLQYGELDIIQAKYSILDRAMENELLPLCRDNGIVVQVYSPLEQGLLTGTITRDYVPGGARANKVWFQRENMLKVIDMLEQWQPLCARYQCTIPTLALAWILKQSDLISILSGATAPEQVRENVAALNINLSDADATLMREM
20 -> 21 TW
217 -> 222 YSPLEQ
232 -> 232 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.23 - methylglyoxal metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0019170 - methylglyoxal reductase (NADH-dependent) activity
GO:0016491 - oxidoreductase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6958-MONOMER
ECOLIWIKI:
b1771
INTERPRO:
IPR036812
INTERPRO:
IPR023210
INTERPRO:
IPR020471
MODBASE:
P77256
PFAM:
PF00248
PRIDE:
P77256
PRINTS:
PR00069
REFSEQ:
NP_416285
SMR:
P77256
SWISSMODEL:
P77256
UNIPROT:
P77256


Operon      
Name: ydjLKJIHG         
Operon arrangement:
Transcription unit        Promoter
ydjLKJIHG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydjFp7 1854886 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydjFp1 1854924 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB