RegulonDB RegulonDB 11.0: Gene Form
   

ydjJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydjK ydjJ ydjI

Gene      
Name: ydjJ    Texpresso search in the literature
Synonym(s): ECK1772, G6961, b1774
Genome position(nucleotides): 1857790 <-- 1858833
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.74
External database links:  
ASAP:
ABE-0005908
ECHOBASE:
EB3259
ECOLIHUB:
ydjJ
OU-MICROARRAY:
b1774
STRING:
511145.b1774
COLOMBOS: ydjJ


Product      
Name: putative zinc-binding dehydrogenase YdjJ
Synonym(s): YdjJ, putative oxidoreductase, Zn-dependent and NAD(P)-binding
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.701
Isoelectric point: 6.389
Motif(s):
 
Type Positions Sequence Comment
27 -> 139 DEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQEIGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPNYRGALTHYLCHPESFTYKL
180 -> 301 IGLMTLQACKCLGATEIAVVDVLEKRLAMAEQLGATVVINGAKEDTIARCQQFTEDMGADIVFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVTI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008270 - zinc ion binding
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ALPHAFOLD:
P77280
ECOCYC:
G6961-MONOMER
ECOLIWIKI:
b1774
INTERPRO:
IPR011032
INTERPRO:
IPR002328
INTERPRO:
IPR013154
INTERPRO:
IPR036291
INTERPRO:
IPR020843
INTERPRO:
IPR013149
MODBASE:
P77280
PDB:
5VM2
PFAM:
PF08240
PFAM:
PF00107
PRIDE:
P77280
PROSITE:
PS00059
REFSEQ:
NP_416288
SMART:
SM00829
SMR:
P77280
UNIPROT:
P77280


Operon      
Name: ydjLKJIHG         
Operon arrangement:
Transcription unit        Promoter
ydjLKJIHG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056


RegulonDB