RegulonDB RegulonDB 10.9: Gene Form
   

yeaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydjL msrB yeaC Cra gapAp6 gapAp6 gapAp7 gapAp7 TSS_2078 TSS_2078

Gene      
Name: yeaC    Texpresso search in the literature
Synonym(s): ECK1775, G6964, b1777
Genome position(nucleotides): 1861702 <-- 1861974 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.05
External database links:  
ASAP:
ABE-0005914
ECHOBASE:
EB3262
ECOLIHUB:
yeaC
OU-MICROARRAY:
b1777
STRING:
511145.b1777
COLOMBOS: yeaC


Product      
Name: DUF1315 domain-containing protein YeaC
Synonym(s): YeaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.338
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence
5 -> 80 DIINSMMPEVYQRLSTAVELGKWPDGVALTEEQKENCLQLVMLWQARHNIEAQHMTIDTNGQMVMKSKQQLKEDFG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6964-MONOMER
ECOLIWIKI:
b1777
INTERPRO:
IPR009749
PFAM:
PF07023
PRIDE:
P76231
REFSEQ:
NP_416291
UNIPROT:
P76231


Operon      
Name: yeaC         
Operon arrangement:
Transcription unit        Promoter
yeaC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2078 1861527 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB