RegulonDB RegulonDB 10.9: Gene Form
   

yoaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeaR yeaQ yoaG yeaQp1 yeaQp1 yeaQp3 yeaQp3 TSS_2127 TSS_2127

Gene      
Name: yoaG    Texpresso search in the literature
Synonym(s): ECK1794, G6982, b1796
Genome position(nucleotides): 1879403 <-- 1879585 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.9
External database links:  
ASAP:
ABE-0005976
ECHOBASE:
EB4052
ECOLIHUB:
yoaG
OU-MICROARRAY:
b1796
STRING:
511145.b1796
COLOMBOS: yoaG


Product      
Name: DUF1869 domain-containing protein YoaG
Synonym(s): YoaG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 6.608
Isoelectric point: 3.897
Motif(s):
 
Type Positions Sequence
3 -> 60 KATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6982-MONOMER
ECOLIWIKI:
b1796
INTERPRO:
IPR036489
INTERPRO:
IPR015051
MODBASE:
P64496
PDB:
1NEI
PFAM:
PF08956
PRIDE:
P64496
REFSEQ:
NP_416310
SMR:
P64496
UNIPROT:
P64496


Operon      
Name: yeaR-yoaG         
Operon arrangement:
Transcription unit        Promoter
yeaR-yoaG


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, NarP
Repressed by: NsrR, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2127 1879297 reverse nd [RS-EPT-CBR] [1]
  promoter yeaQp3 1879360 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yeaQp1 1879390 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB