RegulonDB RegulonDB 10.9: Gene Form
   

yeaX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rnd yeaW yeaX

Gene      
Name: yeaX    Texpresso search in the literature
Synonym(s): ECK1801, G6989, b1803
Genome position(nucleotides): 1885845 --> 1886810 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.1
External database links:  
ASAP:
ABE-0006000
ECHOBASE:
EB3283
ECOLIHUB:
yeaX
OU-MICROARRAY:
b1803
STRING:
511145.b1803
COLOMBOS: yeaX


Product      
Name: carnitine monooxygenase subunit YeaX
Synonym(s): YeaX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.661
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
242 -> 312 SGKEFVVPEEMTILQVIENNKAAKVECLCREGVCGTCETAILEGEADHRDQYFSDEERASQQSMLICCSRA
4 -> 109 YQMFEVQVSQVEPLTEQVKRFTLVATDGKPLPAFTGGSHVIVQMSDGDNQYSNAYSLLSSPHDTSCYQIAVRLEENSRGGSRFLHQQVKVGDRLTISTPNNLFALI
117 -> 207 FIAGGIGITPFLSHMAELQHSDVDWQLHYCSRNPESCAFRDELVQHPQAEKVHLHHSSTGTRLELARLLADIEPGTHVYTCGPEALIEAVR
233 -> 321 DAFTLVLARSGKEFVVPEEMTILQVIENNKAAKVECLCREGVCGTCETAILEGEADHRDQYFSDEERASQQSMLICCSRAKGKRLVLDL
9 -> 103 VQVSQVEPLTEQVKRFTLVATDGKPLPAFTGGSHVIVQMSDGDNQYSNAYSLLSSPHDTSCYQIAVRLEENSRGGSRFLHQQVKVGDRLTISTPN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0016709 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
biological_process GO:0009437 - carnitine metabolic process
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6989-MONOMER
ECOLIWIKI:
b1803
INTERPRO:
IPR001041
INTERPRO:
IPR001433
INTERPRO:
IPR039003
INTERPRO:
IPR008333
INTERPRO:
IPR012675
INTERPRO:
IPR017927
INTERPRO:
IPR017938
INTERPRO:
IPR036010
INTERPRO:
IPR000951
INTERPRO:
IPR039261
INTERPRO:
IPR006058
MODBASE:
P76254
PFAM:
PF00175
PFAM:
PF00970
PFAM:
PF00111
PRIDE:
P76254
PRINTS:
PR00409
PROSITE:
PS51085
PROSITE:
PS51384
PROSITE:
PS00197
REFSEQ:
NP_416317
SMR:
P76254
UNIPROT:
P76254


Operon      
Name: yeaX         
Operon arrangement:
Transcription unit        Promoter
yeaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB