RegulonDB RegulonDB 10.9: Gene Form
   

pdeD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeD yoaE sdaA yoaL

Gene      
Name: pdeD    Texpresso search in the literature
Synonym(s): ECK1813, G6996, b1815, yoaD
Genome position(nucleotides): 1898427 --> 1900025 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.53
External database links:  
ASAP:
ABE-0006043
ECHOBASE:
EB3289
ECOLIHUB:
yoaD
OU-MICROARRAY:
b1815
STRING:
511145.b1815
COLOMBOS: pdeD


Product      
Name: putative c-di-GMP phosphodiesterase PdeD
Synonym(s): PdeD, YoaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space,cytosol
Molecular weight: 59.711
Isoelectric point: 8.916
Motif(s):
 
Type Positions Sequence
16 -> 36 MIVCTICALVTLASTLSVRFI
43 -> 240 QQRVVQFANHAVEELDKVLLPLQAGSEVLLPLIGLPCSVAHLPLRKQAAKLQTVRSIGLVQDGTLYCSSIFGYRNVPVVDILAELPAPQPLLRLTIDRALIKGSPVLIQWTPAAGSSNAGVMEMINIDLLTAMLLEPQLPQISSASLTVDKRHLLYGNGLVDSLPQPEDNENYQVSSQRFPFTINVNGPGATALAWHY
266 -> 515 RMSFSREINLGLAQHEFELFCQPLLNARSQQCIGVEILLRWNNPRQGWISPDVFIPIAEEHHLIVPLTRYVMAETIRQRHVFPMSSQFHVGINVAPSHFRRGVLIKDLNQYWFSAHPIQQLILEITERDALLDVDYRIARELHRKNVKLAIDDFGTGNSSFSWLETLRPDVLKIDKSFTAAIGSDAVNSTVTDIIIALGQRLNIELVAEGVETQEQAKYLRRHGVHILQGYLYAQPMPLRDFPKWLAGSQ
245 -> 265 LPLAVLLSLLVGYIAWLATAY
17 -> 36 IVCTICALVTLASTLSVRFI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016787 - hydrolase activity
GO:0071111 - cyclic-guanylate-specific phosphodiesterase activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
Reference(s): [1] Sarenko O., et al., 2017
External database links:  
ECOCYC:
G6996-MONOMER
ECOLIWIKI:
b1815
INTERPRO:
IPR035919
INTERPRO:
IPR024744
INTERPRO:
IPR001633
PFAM:
PF00563
PFAM:
PF12792
PRIDE:
P76261
PROSITE:
PS50883
REFSEQ:
NP_416329
SMART:
SM00052
SMR:
P76261
UNIPROT:
P76261


Operon      
Name: pdeD         
Operon arrangement:
Transcription unit        Promoter
pdeD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sarenko O., Klauck G., Wilke FM., Pfiffer V., Richter AM., Herbst S., Kaever V., Hengge R., 2017, More than Enzymes That Make or Break Cyclic Di-GMP-Local Signaling in the Interactome of GGDEF/EAL Domain Proteins of Escherichia coli., MBio 8(5)


RegulonDB