RegulonDB RegulonDB 10.8: Gene Form
   

yebO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebO yobF mgrB BtsR BtsR BtsR Cis-reg; thermoregulator terminator yobFp1 yobFp1 yobFp2 yobFp2 cspCp8 cspCp8

Gene      
Name: yebO    Texpresso search in the literature
Synonym(s): ECK1823, G7001, b1825
Genome position(nucleotides): 1908261 <-- 1908548 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.4
External database links:  
ASAP:
ABE-0006075
ECHOBASE:
EB3770
OU-MICROARRAY:
b1825
PortEco:
yebO
STRING:
511145.b1825
COLOMBOS: yebO


Product      
Name: uncharacterized protein YebO
Synonym(s): YebO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 10.792
Isoelectric point: 4.673
Motif(s):
 
Type Positions Sequence
16 -> 95 VVSVVVLLIGLILWFFINRASSRTNEQIELLEALLDQQKRQNALLRRLCEANEPEKADKKTVESQKSVEDEDIIRLVAER
12 -> 32 IASLVVSVVVLLIGLILWFFI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-48171N
ECOCYC:
G7001-MONOMER
ECOLIWIKI:
b1825
INTERPRO:
IPR025594
PFAM:
PF13974
PRIDE:
P64499
REFSEQ:
NP_416339
UNIPROT:
P64499


Operon      
Name: yebO         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cspCp8 1907509 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB