RegulonDB RegulonDB 10.9: Gene Form
   

msrC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebS proQ msrC yebT TSS_2181 TSS_2181 yebSp6 yebSp6 TSS_2180 TSS_2180 TSS_2179 TSS_2179 yebSp5 yebSp5 prcp1 prcp1

Gene      
Name: msrC    Texpresso search in the literature
Synonym(s): ECK1831, G7005, b1832, yebR
Genome position(nucleotides): 1915631 <-- 1916128 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.2
External database links:  
ASAP:
ABE-0006095
ECHOBASE:
EB3774
ECOLIHUB:
yebR
OU-MICROARRAY:
b1832
STRING:
511145.b1832
COLOMBOS: msrC


Product      
Name: free methionine-(R)-sulfoxide reductase
Synonym(s): MsrC, YebR, fRMsr
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.122
Isoelectric point: 4.418
Motif(s):
 
Type Positions Sequence
49 -> 149 LLEDDTLVLGPFQGKIACVRIPVGRGVCGTAVARNQVQRIEDVHVFDGHIACDAASNSEIVLPLVVKNQIIGVLDIDSTVFGRFTDEDEQGLRQLVAQLEK
32 -> 151 SALLYERLTDINWAGFYLLEDDTLVLGPFQGKIACVRIPVGRGVCGTAVARNQVQRIEDVHVFDGHIACDAASNSEIVLPLVVKNQIIGVLDIDSTVFGRFTDEDEQGLRQLVAQLEKVL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0070191 - methionine-R-sulfoxide reductase activity
GO:0016491 - oxidoreductase activity
GO:0042803 - protein homodimerization activity
GO:0033745 - L-methionine-(R)-S-oxide reductase activity
biological_process GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-11813N
ECOCYC:
G7005-MONOMER
ECOLIWIKI:
b1832
INTERPRO:
IPR000614
INTERPRO:
IPR029016
INTERPRO:
IPR003018
MODBASE:
P76270
PDB:
1VHM
PFAM:
PF13185
PRIDE:
P76270
PROSITE:
PS01320
REFSEQ:
NP_416346
SMART:
SM00065
SMR:
P76270
SWISSMODEL:
P76270
UNIPROT:
P76270


Operon      
Name: msrC         
Operon arrangement:
Transcription unit        Promoter
msrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter prcp1 1915027 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yebSp5 1916119 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2179 1916143 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2180 1916164 reverse nd [RS-EPT-CBR] [2]
  promoter yebSp6 1916181 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2181 1916234 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB