RegulonDB RegulonDB 10.9: Gene Form
   

letA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebT rsmF yebS msrC RyeB TSS_2183 TSS_2183 TSS_2182 TSS_2182 TSS_2181 TSS_2181 yebSp6 yebSp6 TSS_2180 TSS_2180 TSS_2179 TSS_2179 yebSp5 yebSp5

Gene      
Name: letA    Texpresso search in the literature
Synonym(s): ECK1832, G7006, b1833, yebS
Genome position(nucleotides): 1916258 --> 1917541 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.08
External database links:  
ASAP:
ABE-0006098
ECHOBASE:
EB3775
ECOLIHUB:
yebS
OU-MICROARRAY:
b1833
STRING:
511145.b1833
COLOMBOS: letA


Product      
Name: intermembrane transport protein LetA
Synonym(s): LetA, YebS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 48.273
Isoelectric point: 9.165
Motif(s):
 
Type Positions Sequence
66 -> 217 LTRLAAMAFTMLLLMPFAWGEPLLHIWLLGIRIDANVMQGIWQMTKQGDAITGSMVFFCVIGAPLILVTSIAYLWFGNRLGMNLRPVLLMLERLKEWVMLDIYLVGIGVASIKVQDYAHIQAGVGLFSFVALVILTTVTLSHLNVEELWERF
159 -> 179 LKEWVMLDIYLVGIGVASIKV
121 -> 141 VFFCVIGAPLILVTSIAYLWF
270 -> 290 LLASIVLLLPANLLPISIIYL
383 -> 403 ILAFTMGPAAFYFGAAVILTI

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0120009 - intermembrane lipid transfer
GO:0009408 - response to heat
GO:0046907 - intracellular transport
GO:0061024 - membrane organization
Note(s): Note(s): ...[more].
Reference(s): [1] Daley DO., et al., 2005
[2] Ekiert DC., et al., 2017
[3] Kumar A., et al., 2016
[4] Rapp M., et al., 2004
External database links:  
DIP:
DIP-48172N
ECOCYC:
G7006-MONOMER
ECOLIWIKI:
b1833
INTERPRO:
IPR005219
INTERPRO:
IPR007498
INTERPRO:
IPR011031
PFAM:
PF04403
PRIDE:
P0AD03
PROSITE:
PS51008
REFSEQ:
NP_416347
UNIPROT:
P0AD03


Operon      
Name: letAB         
Operon arrangement:
Transcription unit        Promoter
letAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yebSp5 1916119 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_2179 1916143 forward nd [RS-EPT-CBR] [6]
  promoter TSS_2180 1916164 reverse nd [RS-EPT-CBR] [6]
  promoter yebSp6 1916181 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_2181 1916234 forward nd [RS-EPT-CBR] [6]
  promoter TSS_2182 1918414 forward nd [RS-EPT-CBR] [6]
  promoter TSS_2183 1920196 forward nd [RS-EPT-CBR] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Daley DO., Rapp M., Granseth E., Melen K., Drew D., von Heijne G., 2005, Global topology analysis of the Escherichia coli inner membrane proteome., Science 308(5726):1321-3

 [2] Ekiert DC., Bhabha G., Isom GL., Greenan G., Ovchinnikov S., Henderson IR., Cox JS., Vale RD., 2017, Architectures of Lipid Transport Systems for the Bacterial Outer Membrane., Cell 169(2):273-285.e17

 [3] Kumar A., Beloglazova N., Bundalovic-Torma C., Phanse S., Deineko V., Gagarinova A., Musso G., Vlasblom J., Lemak S., Hooshyar M., Minic Z., Wagih O., Mosca R., Aloy P., Golshani A., Parkinson J., Emili A., Yakunin AF., Babu M., 2016, Conditional Epistatic Interaction Maps Reveal Global Functional Rewiring of Genome Integrity Pathways in Escherichia coli., Cell Rep 14(3):648-61

 [4] Rapp M., Drew D., Daley DO., Nilsson J., Carvalho T., Melen K., De Gier JW., Von Heijne G., 2004, Experimentally based topology models for E. coli inner membrane proteins., Protein Sci 13(4):937-45

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB