RegulonDB RegulonDB 10.8: Gene Form
   

yebT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebT rsmF yebS msrC RyeB TSS_2183 TSS_2183 TSS_2182 TSS_2182 TSS_2181 TSS_2181 yebSp6 yebSp6 TSS_2180 TSS_2180 TSS_2179 TSS_2179 yebSp5 yebSp5

Gene      
Name: yebT    Texpresso search in the literature
Synonym(s): ECK1833, G7007, b1834, letB
Genome position(nucleotides): 1917510 --> 1920143 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.64
External database links:  
ASAP:
ABE-0006101
ECHOBASE:
EB3776
OU-MICROARRAY:
b1834
PortEco:
yebT
STRING:
511145.b1834
COLOMBOS: yebT


Product      
Name: intermembrane transport protein YebT
Synonym(s): LetB, YebT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 94.97
Isoelectric point: 5.919
Motif(s):
 
Type Positions Sequence
46 -> 137 GNTVTIDFMSADGIVPGRTPVRYQGVEVGTVQDISLSDDLRKIEVKVSIKSDMKDALREETQFWLVTPKASLAGVSGLDALVGGNYIGMMPG
163 -> 220 IHLQAPDLGSLNSGSLVYFRKIPVGKVYDYAINPNKQGVVIDVLIERRFTDLVKKGSR
747 -> 810 GLSIIVEAPEAGSLGIGTPVLFRGLEVGTVTGMTLGTLSDRVMIAMRISKRYQHLVRNNSVFWL
20 -> 40 ISPFWLLPFIALMIASWLIWD
280 -> 351 GVIIKLELPSGAGLTADSTPLMYQGLEVGQLTKLDLNPGGKVTGEMTVDPSVVTLLRENTRIELRNPKLSLS

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0042802 - identical protein binding
biological_process GO:0120009 - intermembrane lipid transfer
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Lomize AL., et al., 2017
[2] Nakayama T., et al., 2017
[3] Zhai Y., et al., 2002
External database links:  
DIP:
DIP-11815N
ECOCYC:
G7007-MONOMER
ECOLIWIKI:
b1834
INTERPRO:
IPR003399
PDB:
6KZ3
PDB:
6KZ4
PFAM:
PF02470
PRIDE:
P76272
REFSEQ:
NP_416348
SMR:
P76272
UNIPROT:
P76272


Operon      
Name: yebST         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yebSp5 1916119 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2179 1916143 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2180 1916164 reverse nd [RS-EPT-CBR] [5]
  promoter yebSp6 1916181 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2181 1916234 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2182 1918414 forward nd [RS-EPT-CBR] [5]
  promoter TSS_2183 1920196 forward nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lomize AL., Lomize MA., Krolicki SR., Pogozheva ID., 2017, Membranome: a database for proteome-wide analysis of single-pass membrane proteins., Nucleic Acids Res 45(D1):D250-D255

 [2] Nakayama T., Zhang-Akiyama QM., 2017, pqiABC and yebST, Putative mce Operons of Escherichia coli, Encode Transport Pathways and Contribute to Membrane Integrity., J Bacteriol 199(1)

 [3] Zhai Y., Saier MH., 2002, The beta-barrel finder (BBF) program, allowing identification of outer membrane beta-barrel proteins encoded within prokaryotic genomes., Protein Sci 11(9):2196-207

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB