RegulonDB RegulonDB 10.9: Gene Form
   

yebW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pphA yebV yebW yebWp6 yebWp6 yebWp3 yebWp3

Gene      
Name: yebW    Texpresso search in the literature
Synonym(s): ECK1836, G7010, b1837
Genome position(nucleotides): 1922121 --> 1922312 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.83
External database links:  
ASAP:
ABE-0006112
ECHOBASE:
EB3779
ECOLIHUB:
yebW
OU-MICROARRAY:
b1837
STRING:
511145.b1837
COLOMBOS: yebW


Product      
Name: DUF1482 domain-containing protein YebW
Synonym(s): YebW
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.315
Isoelectric point: 3.63
Motif(s):
 
Type Positions Sequence
1 -> 57 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFIDGFWRPA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G7010-MONOMER
ECOLIWIKI:
b1837
INTERPRO:
IPR009954
PFAM:
PF07358
PRIDE:
P76275
REFSEQ:
NP_416351
UNIPROT:
P76275


Operon      
Name: yebW         
Operon arrangement:
Transcription unit        Promoter
yebW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yebWp3 1921957 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yebWp6 1922084 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB