RegulonDB RegulonDB 10.9: Gene Form
   

yebY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebZ yebY ryeA sdsR anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator pphAp pphAp sdsRp sdsRp

Gene      
Name: yebY    Texpresso search in the literature
Synonym(s): ECK1840, G7012, b1839
Genome position(nucleotides): 1923365 <-- 1923706 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.91
External database links:  
ASAP:
ABE-0006118
ECHOBASE:
EB3781
ECOLIHUB:
yebY
OU-MICROARRAY:
b1839
STRING:
511145.b1839
COLOMBOS: yebY


Product      
Name: DUF2511 domain-containing protein YebY
Synonym(s): YebY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.378
Isoelectric point: 8.2
Motif(s):
 
Type Positions Sequence
21 -> 113 APQVITVSRFEVGKDKWAFNREEVMLTCRPGNALYVINPSTLVQYPLNDIAQKEVASGKTNAQPISVIQIDDPNNPGEKMSLAPFIERAEKLC
1 -> 20 MMKKSILAFLLLTSSAAALA
26 -> 113 TVSRFEVGKDKWAFNREEVMLTCRPGNALYVINPSTLVQYPLNDIAQKEVASGKTNAQPISVIQIDDPNNPGEKMSLAPFIERAEKLC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48174N
ECOCYC:
G7012-MONOMER
ECOLIWIKI:
b1839
INTERPRO:
IPR019648
PFAM:
PF10709
PRIDE:
P64506
REFSEQ:
NP_416353
SMR:
P64506
UNIPROT:
P64506


Operon      
Name: yobA-yebZY         
Operon arrangement:
Transcription unit        Promoter
yobA-yebZY


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB