RegulonDB RegulonDB 10.10: Gene Form
   

uspC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

otsA uspC insAB5 insA5 insB5 otsB uspCp4 uspCp4 uspCp5 uspCp5 uspCp6 uspCp6 uspCp2 uspCp2 uspCp9 uspCp9 uspCp8 uspCp8 TSS_2233 TSS_2233 insA-5p insA-5p TSS_2232 TSS_2232

Gene      
Name: uspC    Texpresso search in the literature
Synonym(s): ECK1894, G7031, b1895, yecG
Genome position(nucleotides): 1979753 --> 1980181 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.99
External database links:  
ASAP:
ABE-0006316
ECHOBASE:
EB2704
ECOLIHUB:
uspC
OU-MICROARRAY:
b1895
STRING:
511145.b1895
COLOMBOS: uspC


Product      
Name: universal stress protein C
Synonym(s): UspC, YecG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.633
Isoelectric point: 5.779
Motif(s):
 
Type Positions Sequence
3 -> 138 YSNILVAVAVTPESQQLLAKAVSIARPVKGHISLITLASDPEMYNQLAAPMLEDLRSVMHEETQSFLDKLIQDAGYPVDKTFIAYGELSEHILEVCHKHHFDLVICGNHNHSFFSRASCSAKRVIASSEVDVLLVP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations
  5 - cell processes --> 5.6 - protection --> 5.6.1 - radiation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0060090 - molecular adaptor activity
GO:0042803 - protein homodimerization activity
biological_process GO:0009267 - cellular response to starvation
GO:0009651 - response to salt stress
GO:0034644 - cellular response to UV
External database links:  
ECOCYC:
G7031-MONOMER
ECOLIWIKI:
b1895
INTERPRO:
IPR014729
INTERPRO:
IPR006016
INTERPRO:
IPR006015
MODBASE:
P46888
PANTHER:
PTHR46268
PFAM:
PF00582
PRIDE:
P46888
PRODB:
PRO_000024192
REFSEQ:
NP_416409
SMR:
P46888
UNIPROT:
P46888


Operon      
Name: uspC         
Operon arrangement:
Transcription unit        Promoter
uspC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2232 1979050 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2233 1979233 reverse nd [RS-EPT-CBR] [1]
  promoter uspCp8 1979586 forward nd [ICWHO] [2]
  promoter uspCp9 1979591 forward nd [ICWHO] [2]
  promoter uspCp2 1979598 forward nd [ICWHO] [2]
  promoter uspCp6 1979619 forward nd [ICWHO] [2]
  promoter uspCp5 1979658 forward nd [ICWHO] [2]
  promoter uspCp4 1979668 forward nd [ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB