RegulonDB RegulonDB 10.8: Gene Form
   

yedL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yedN yedK yedL fliE intG anti-anti-terminator anti-terminator terminator

Gene      
Name: yedL    Texpresso search in the literature
Synonym(s): ECK1931, G7040, b1932
Genome position(nucleotides): 2010600 --> 2011079 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.08
External database links:  
ASAP:
ABE-0006433
ECHOBASE:
EB3064
OU-MICROARRAY:
b1932
PortEco:
yedL
STRING:
511145.b1932
COLOMBOS: yedL


Product      
Name: putative acetyltransferase YedL
Synonym(s): YedL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.891
Isoelectric point: 7.0
Motif(s):
 
Type Positions Sequence
30 -> 130 PPESSHALDVQKLRNPTVTFWSVWEGEQLAGIGALKLLDDKHGELKSMRTAPNYLRRGVASLILRHILQVAQDRCLHRLSLETGTQAGFTACHQLYLKHGF
4 -> 153 IKTDDLTHPAVQALVAYHISGMLQQSPPESSHALDVQKLRNPTVTFWSVWEGEQLAGIGALKLLDDKHGELKSMRTAPNYLRRGVASLILRHILQVAQDRCLHRLSLETGTQAGFTACHQLYLKHGFADCEPFADYRLDPHSRFLSLTLC

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7040-MONOMER
ECOLIWIKI:
b1932
INTERPRO:
IPR000182
INTERPRO:
IPR016181
MODBASE:
P76319
PFAM:
PF00583
PRIDE:
P76319
PROSITE:
PS51186
REFSEQ:
NP_416442
SMR:
P76319
SWISSMODEL:
P76319
UNIPROT:
P76319


Operon      
Name: yedL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB