RegulonDB RegulonDB 10.9: Gene Form
   

yedN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yedN yedL fliE intG anti-anti-terminator anti-terminator terminator

Gene      
Name: yedN    Texpresso search in the literature
Synonym(s): ECK1932, ECK1933, G7043, b1933, b1934, b1935, b4495, yedM
Type: Pseudo Gene
Genome position(nucleotides): 2011223 <-- 2012351 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
33.75
External database links:  
ASAP:
ABE-0006437
ASAP:
ABE-0285096
ASAP:
ABE-0006440
ASAP:
ABE-0006435
ECHOBASE:
EB3065
ECOLIHUB:
yedM
ECOLIHUB:
yedN_1
ECOLIHUB:
yedN_2
ECOO157CYC:
Z3023
ECOO157CYC:
Z3026
OU-MICROARRAY:
b1935
OU-MICROARRAY:
b1933
OU-MICROARRAY:
b1934
STRING:
316407.85675165
COLOMBOS: yedN


Product      
Name: putative type III secreted effector, N-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 10.233
Motif(s):
 
Type Positions Sequence
1 -> 116 MFPLNDLSLKTQPVQLNKVTSNTESTIKQHELVSDDAIINELSSELVSCLGNGKFTPISEDSKLFNMLSEFKLLHSEYFEWGDYSLWFQDFSIYNKIGFIMIEKIRELVTHPFGIN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7043-MONOMER
ECOLIWIKI:
b1935
ECOO157CYC:
Z3026-MONOMER
ECOO157CYC:
Z3023-MONOMER
INTERPRO:
IPR020484
PFAM:
PF17607
PRIDE:
P76322
PRODOM:
PD074737
REFSEQ:
NP_416445
SMR:
P76322
UNIPROT:
P76322


Operon      
Name: yedN         
Operon arrangement:
Transcription unit        Promoter
yedN


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB