RegulonDB RegulonDB 10.8: Gene Form
   

yedN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yedN yedL fliE intG anti-anti-terminator anti-terminator terminator

Gene      
Name: yedN    Texpresso search in the literature
Synonym(s): ECK1932, ECK1933, G7043, b1933, b1934, b1935, b4495, yedM
Type: Pseudo Gene
Genome position(nucleotides): 2011223 <-- 2012351 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
33.75
External database links:  
ASAP:
ABE-0006435
ASAP:
ABE-0006437
ASAP:
ABE-0006440
ASAP:
ABE-0285096
ECHOBASE:
EB3065
ECOO157CYC:
Z3023
ECOO157CYC:
Z3026
OU-MICROARRAY:
b1935
OU-MICROARRAY:
b1934
OU-MICROARRAY:
b1933
PortEco:
yedM
PortEco:
yedN_1
PortEco:
yedN_2
STRING:
316407.85675165
COLOMBOS: yedN


Product      
Name: putative type III secreted effector, N-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 10.233
Motif(s):
 
Type Positions Sequence
1 -> 116 MFPLNDLSLKTQPVQLNKVTSNTESTIKQHELVSDDAIINELSSELVSCLGNGKFTPISEDSKLFNMLSEFKLLHSEYFEWGDYSLWFQDFSIYNKIGFIMIEKIRELVTHPFGIN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7043-MONOMER
ECOLIWIKI:
b1935
ECOO157CYC:
Z3023-MONOMER
ECOO157CYC:
Z3026-MONOMER
INTERPRO:
IPR020484
PFAM:
PF17607
PRIDE:
P76322
PRODOM:
PD074737
REFSEQ:
NP_416445
SMR:
P76322
UNIPROT:
P76322


Operon      
Name: yedN         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB