RegulonDB RegulonDB 10.9: Gene Form
   

dsrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rcsA yodD dsrB terminator anti-terminator anti-anti-terminator TSS_2272 TSS_2272 dsrBp5 dsrBp5 TSS_2271 TSS_2271

Gene      
Name: dsrB    Texpresso search in the literature
Synonym(s): ECK1950, G7045, b1952
Genome position(nucleotides): 2024635 <-- 2024823 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.32
External database links:  
ASAP:
ABE-0006484
ECHOBASE:
EB2517
ECOLIHUB:
dsrB
OU-MICROARRAY:
b1952
STRING:
511145.b1952
COLOMBOS: dsrB


Product      
Name: protein DsrB
Synonym(s): DsrB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.946
Isoelectric point: 4.304
Motif(s):
 
Type Positions Sequence
1 -> 60 MKVNDRVTVKTDGGPRRPGVVLAVEEFSEGTMYLVSLEDYPLGIWFFNEAGHQDGIFVEK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7045-MONOMER
ECOLIWIKI:
b1952
INTERPRO:
IPR019717
PFAM:
PF10781
PRIDE:
P0AEG8
PRODB:
PRO_000022488
REFSEQ:
NP_416462
SMR:
P0AEG8
UNIPROT:
P0AEG8


Operon      
Name: dsrB         
Operon arrangement:
Transcription unit        Promoter
dsrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2271 2024841 reverse nd [RS-EPT-CBR] [1]
  promoter dsrBp5 2024843 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2272 2024844 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB