RegulonDB RegulonDB 10.9: Gene Form
   

dgcQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcQ yedP yodC dsrA DksA-ppGpp DksA-ppGpp terminator dsrAp dsrAp

Gene      
Name: dgcQ    Texpresso search in the literature
Synonym(s): ECK1954, G7049, b1956, yedQ
Genome position(nucleotides): 2026323 <-- 2028017 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.39
External database links:  
ASAP:
ABE-0006495
ECHOBASE:
EB3794
ECOLIHUB:
yedQ
OU-MICROARRAY:
b1956
STRING:
511145.b1956
COLOMBOS: dgcQ


Product      
Name: putative diguanylate cyclase DgcQ
Synonym(s): DgcQ, YedQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 64.283
Isoelectric point: 7.22
Motif(s):
 
Type Positions Sequence
41 -> 227 TWREVVVLEDAYISSQRNHLENVANALDKHLQYNVDKLIFLRNGMREALVAPLDFTSLRDAVTEFEQHRDEHAWKIELNRRRTLPVNGVSDALVSEGNLLSRENESLDNEITAALEVGYLLRLAHNSSSMVEQAMYVSRAGFYVSTQPTLFTRNVPTRYYGYVTQPWFIGHSQRENRHRAVRWFTSQ
428 -> 563 HPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDN
398 -> 557 AWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNR
20 -> 40 LGPGHVVNLCFIVVLLFSTLL
360 -> 380 IALTLLWALFTTMLLISWYVI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0052621 - diguanylate cyclase activity
biological_process GO:0030244 - cellulose biosynthetic process
GO:0043709 - cell adhesion involved in single-species biofilm formation
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Boehm A., et al., 2010
External database links:  
ECOCYC:
G7049-MONOMER
ECOLIWIKI:
b1956
INTERPRO:
IPR033416
INTERPRO:
IPR029787
INTERPRO:
IPR000160
INTERPRO:
IPR043128
PFAM:
PF00990
PFAM:
PF17151
PRIDE:
P76330
PROSITE:
PS50887
REFSEQ:
NP_416465
SMART:
SM00267
SMR:
P76330
UNIPROT:
P76330


Operon      
Name: dgcQ         
Operon arrangement:
Transcription unit        Promoter
dgcQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Boehm A., Kaiser M., Li H., Spangler C., Kasper CA., Ackermann M., Kaever V., Sourjik V., Roth V., Jenal U., 2010, Second messenger-mediated adjustment of bacterial swimming velocity., Cell 141(1):107-16


RegulonDB