RegulonDB RegulonDB 10.9: Gene Form
   

yodC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcQ yedI yodC yedP yodCp6 yodCp6 yodCp7 yodCp7 TSS_2273 TSS_2273

Gene      
Name: yodC    Texpresso search in the literature
Synonym(s): ECK1955, G7050, b1957
Genome position(nucleotides): 2028188 <-- 2028370 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.01
External database links:  
ASAP:
ABE-0006498
ECHOBASE:
EB4054
ECOLIHUB:
yodC
OU-MICROARRAY:
b1957
STRING:
511145.b1957
COLOMBOS: yodC


Product      
Name: protein YodC
Synonym(s): YodC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.678
Isoelectric point: 4.355
Motif(s):
 
Type Positions Sequence
9 -> 47 VTVKEGGPRMIVTGYSSGMVECRWYDGYGVKREAFHETE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48226N
ECOCYC:
G7050-MONOMER
ECOLIWIKI:
b1957
INTERPRO:
IPR019226
PFAM:
PF09926
PRIDE:
P64517
REFSEQ:
NP_416466
UNIPROT:
P64517


Operon      
Name: yodC         
Operon arrangement:
Transcription unit        Promoter
yodC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2273 2028396 reverse nd [RS-EPT-CBR] [1]
  promoter yodCp7 2028410 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yodCp6 2028504 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB