RegulonDB RegulonDB 10.9: Gene Form
   

yedS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yedS hchA rseX hchAp hchAp hchAp2 hchAp2 TSS_2278 TSS_2278 rseXp rseXp

Gene      
Name: yedS    Texpresso search in the literature
Synonym(s): ECK1962, G7052, b1964, b1965, b1966, b4496, yedT
Type: Pseudo Gene
Genome position(nucleotides): 2034051 --> 2035243 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.68
External database links:  
ASAP:
ABE-0285097
ASAP:
ABE-0006526
ASAP:
ABE-0006521
ASAP:
ABE-0006518
ECOLIHUB:
yedS_1
ECOLIHUB:
yedS_2
ECOLIHUB:
yedS_3
ECOO157CYC:
Z2333
ECOO157CYC:
Z3057
OU-MICROARRAY:
b1965
OU-MICROARRAY:
b1966
OU-MICROARRAY:
b1964
COLOMBOS: yedS


Product      
Name: putative outer membrane protein YedS, N-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 7.366
Motif(s):
 
Type Positions Sequence
22 -> 161 AEVYNKDGNKLDLYGKVVGLHYFSDDSGSDGDMSYARIGFKGETQIADQFTGYGQWEFNIGANGPESDKGNTATRLAFAGLGFGQNGTFDYGRNYGVVYDVEAWTDMLPEFGGDTYAGADNFMNGRANGVATYRNNGFFG
1 -> 21 MKRKVLAMLVPALLVAGAANA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Warner DM., et al., 2013
[2] Zhi S., et al., 2016
External database links:  
ECOCYC:
G7052-MONOMER
ECOLIWIKI:
b1964
ECOO157CYC:
Z2333-MONOMER
ECOO157CYC:
Z3057-MONOMER
MODBASE:
P76335
UNIPROT:
P76335


Operon      
Name: yedS         
Operon arrangement:
Transcription unit        Promoter
yedS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2278 2035198 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Warner DM., Yang Q., Duval V., Chen M., Xu Y., Levy SB., 2013, Involvement of MarR and YedS in carbapenem resistance in a clinical isolate of Escherichia coli from China., Antimicrob Agents Chemother 57(4):1935-7

 [2] Zhi S., Li Q., Yasui Y., Banting G., Edge TA., Topp E., McAllister TA., Neumann NF., 2016, An evaluation of logic regression-based biomarker discovery across multiple intergenic regions for predicting host specificity in Escherichia coli., Mol Phylogenet Evol 103:133-42

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB