RegulonDB RegulonDB 10.9: Gene Form
   

hprS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hprS hchA hprR hiuH CusR HprR yedYp4 yedYp4 hiuHp hiuHp TSS_2280 TSS_2280 TSS_2279 TSS_2279 yedVp6 yedVp6

Gene      
Name: hprS    Texpresso search in the literature
Synonym(s): ECK1964, G7056, b1968, yedV
Genome position(nucleotides): 2036794 <-- 2038152 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.66
External database links:  
ASAP:
ABE-0006531
ECHOBASE:
EB3797
ECOLIHUB:
yedV
OU-MICROARRAY:
b1968
STRING:
511145.b1968
COLOMBOS: hprS


Product      
Name: sensor histidine kinase HprS
Synonym(s): HprS, YedV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 50.85
Isoelectric point: 7.658
Motif(s):
 
Type Positions Sequence
242 -> 452 DLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADKNNVLVKLDSLSLNKEVENLLDYLEYLSDEKEICFKVECNQQIFADKILLQRMLSNLIVNAIRYSPEKSRIHITSFLDTNSYLNIDIASPGTKINEPEKLFRRFWRGDNSRHSVGQGLGLSLVKAIAELHGGSATYHYLNKHNVFRITLPQRN
333 -> 333 C
159 -> 179 INSIIICIVAIVLCSVLSPLL
236 -> 299 LSQFADDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARAD
345 -> 450 DKILLQRMLSNLIVNAIRYSPEKSRIHITSFLDTNSYLNIDIASPGTKINEPEKLFRRFWRGDNSRHSVGQGLGLSLVKAIAELHGGSATYHYLNKHNVFRITLPQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0004672 - protein kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0046688 - response to copper ion
GO:0006468 - protein phosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0070301 - cellular response to hydrogen peroxide
GO:0023014 - signal transduction by protein phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Zhou L., et al., 2003
External database links:  
DIP:
DIP-11852N
ECOCYC:
G7056-MONOMER
ECOLIWIKI:
b1968
INTERPRO:
IPR003594
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR006290
INTERPRO:
IPR005467
INTERPRO:
IPR004358
INTERPRO:
IPR003660
INTERPRO:
IPR003661
MODBASE:
P76339
PFAM:
PF02518
PFAM:
PF00512
PRIDE:
P76339
PRINTS:
PR00344
PRODB:
PRO_000025092
PROSITE:
PS50109
PROSITE:
PS50885
REFSEQ:
NP_416477
SMART:
SM00388
SMART:
SM00387
UNIPROT:
P76339


Operon      
Name: hprRS         
Operon arrangement:
Transcription unit        Promoter
hprRS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yedVp6 2038202 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2279 2038513 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2280 2038823 reverse nd [RS-EPT-CBR] [4]
  promoter yedYp4 2039286 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Zhou L., Lei XH., Bochner BR., Wanner BL., 2003, Phenotype microarray analysis of Escherichia coli K-12 mutants with deletions of all two-component systems., J Bacteriol 185(16):4956-72

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB