RegulonDB RegulonDB 10.9: Gene Form
   

hprR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hprS hchA hprR hiuH CusR HprR yedYp4 yedYp4 hiuHp hiuHp TSS_2280 TSS_2280 TSS_2279 TSS_2279 yedVp6 yedVp6

Gene      
Name: hprR    Texpresso search in the literature
Synonym(s): ECK1965, G7057, b1969, yedW
Genome position(nucleotides): 2038152 <-- 2038823 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.79
External database links:  
ASAP:
ABE-0006533
ECHOBASE:
EB3798
ECOLIHUB:
yedW
OU-MICROARRAY:
b1969
STRING:
511145.b1969
COLOMBOS: hprR


Product      
Name: DNA-binding transcriptional dual regulator HprR
Synonym(s): HprR, YedW
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 25.018
Isoelectric point: 6.287
Motif(s):
 
Type Positions Sequence
2 -> 115 KILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLRTAKQTPVICLTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQL
122 -> 220 NSTLEISGLRMDSVSHSVSRDNISITLTRKEFQLLWLLASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPFPEKLIATIRGMGYSFVA
3 -> 112 ILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLRTAKQTPVICLTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVR
146 -> 218 ITLTRKEFQLLWLLASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPFPEKLIATIRGMGYSF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
[ISM] Inferred from Sequence Model
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
[3] Urano H., et al., 2015
External database links:  
DIP:
DIP-11853N
ECOCYC:
G7057-MONOMER
ECOLIWIKI:
b1969
INTERPRO:
IPR006291
INTERPRO:
IPR039420
INTERPRO:
IPR036388
INTERPRO:
IPR016032
INTERPRO:
IPR001789
INTERPRO:
IPR001867
INTERPRO:
IPR011006
MODBASE:
P76340
PANTHER:
PTHR26402
PFAM:
PF00072
PFAM:
PF00486
PRIDE:
P76340
PRODB:
PRO_000025088
PROSITE:
PS50110
PROSITE:
PS51755
REFSEQ:
NP_416478
SMART:
SM00448
SMART:
SM00862
SMR:
P76340
UNIPROT:
P76340


Operon      
Name: hprRS         
Operon arrangement:
Transcription unit        Promoter
hprRS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yedVp6 2038202 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2279 2038513 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2280 2038823 reverse nd [RS-EPT-CBR] [5]
  promoter yedYp4 2039286 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Urano H., Umezawa Y., Yamamoto K., Ishihama A., Ogasawara H., 2015, Cooperative regulation of the common target genes between H2O2-sensing YedVW and Cu2+-sensing CusSR in Escherichia coli., Microbiology 161(Pt 4):729-38

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB