RegulonDB RegulonDB 10.9: Gene Form
   

hiuH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

msrP hprR hiuH CusR HprR TSS_2281 TSS_2281 yedYp4 yedYp4 hiuHp hiuHp TSS_2280 TSS_2280 TSS_2279 TSS_2279 yedVp6 yedVp6

Gene      
Name: hiuH    Texpresso search in the literature
Synonym(s): ECK1966, G7058, b1970, yedX
Genome position(nucleotides): 2038956 --> 2039369 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.79
External database links:  
ASAP:
ABE-0006537
ECHOBASE:
EB3799
ECOLIHUB:
yedX
MIM:
105210
MIM:
115430
MIM:
145680
OU-MICROARRAY:
b1970
STRING:
511145.b1970
COLOMBOS: hiuH


Product      
Name: hydroxyisourate hydrolase / transthyretin-related protein
Synonym(s): HiuH, YedX
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 15.46
Isoelectric point: 9.545
Motif(s):
 
Type Positions Sequence
134 -> 137 YRGS
1 -> 23 MLKRYLVLSVATAAFSLPSLVNA
24 -> 137 AQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS
29 -> 136 LSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0032991 - protein-containing complex
molecular_function GO:0016787 - hydrolase activity
GO:0042802 - identical protein binding
GO:0033971 - hydroxyisourate hydrolase activity
biological_process GO:0006144 - purine nucleobase metabolic process
GO:0051289 - protein homotetramerization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11854N
ECOCYC:
G7058-MONOMER
ECOLIWIKI:
b1970
INTERPRO:
IPR023418
INTERPRO:
IPR000895
INTERPRO:
IPR014306
INTERPRO:
IPR023419
INTERPRO:
IPR036817
INTERPRO:
IPR023416
MODBASE:
P76341
PANTHER:
PTHR10395
PDB:
2IGL
PDB:
2G2P
PDB:
2G2N
PFAM:
PF00576
PRIDE:
P76341
PRINTS:
PR00189
PROSITE:
PS00768
PROSITE:
PS00769
REFSEQ:
NP_416479
SMART:
SM00095
SMR:
P76341
UNIPROT:
P76341


Operon      
Name: hiuH         
Operon arrangement:
Transcription unit        Promoter
hiuH


Transcriptional Regulation      
Display Regulation             
Activated by: HprR, PhoB, CusR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yedVp6 2038202 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2279 2038513 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2280 2038823 reverse nd [RS-EPT-CBR] [2]
  promoter yedYp4 2039286 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2281 2039749 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB