RegulonDB RegulonDB 10.9: Gene Form
   

msrP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

msrP msrQ hiuH TSS_2281 TSS_2281 yedYp4 yedYp4

Gene      
Name: msrP    Texpresso search in the literature
Synonym(s): ECK1967, G7059, b1971, yedY
Genome position(nucleotides): 2039478 --> 2040482 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.14
External database links:  
ASAP:
ABE-0006540
ECHOBASE:
EB3800
ECOLIHUB:
yedY
OU-MICROARRAY:
b1971
STRING:
511145.b1971
COLOMBOS: msrP


Product      
Name: protein-L-methionine sulfoxide reductase catalytic subunit MsrP
Synonym(s): MsrP, YedY, periplasmic protein-L-methionine sulfoxide reductase catalytic subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 37.369
Isoelectric point: 9.545
Motif(s):
 
Type Positions Sequence
91 -> 92 YE
45 -> 334 DLLSWFKGNDRPPAPAGKALEFSKPAAWQNNLPLTPADKVSGYNNFYEFGLDKADPAANAGSLKTDPWTLKISGEVAKPLTLDHDDLTRRFPLEERIYRMRCVEAWSMVVPWIGFPLHKLLALAEPTSNAKYVAFETIYAPEQMPGQQDRFIGGGLKYPYVEGLRLDEAMHPLTLMTVGVYGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTRERPPTTWNLAAPDEYGFYANVNPYVDHPRWSQATERFIGSGGILDVQRQPTLLFNGYAAQVASLYRGLDLRENF
146 -> 146 C
1 -> 44 MKKNQFLKESDVTAESVFFMKRRQVLKALGISATALSLPHAAHA
249 -> 251 GIK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016667 - oxidoreductase activity, acting on a sulfur group of donors
GO:0016675 - oxidoreductase activity, acting on a heme group of donors
GO:0043546 - molybdopterin cofactor binding
GO:0016672 - oxidoreductase activity, acting on a sulfur group of donors, quinone or similar compound as acceptor
biological_process GO:0006979 - response to oxidative stress
GO:0030091 - protein repair
GO:0055114 - oxidation-reduction process
GO:1901530 - response to hypochlorite
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47888N
ECOCYC:
G7059-MONOMER
ECOLIWIKI:
b1971
INTERPRO:
IPR006311
INTERPRO:
IPR036374
INTERPRO:
IPR022867
INTERPRO:
IPR000572
MODBASE:
P76342
PDB:
1XDQ
PDB:
1XDY
PFAM:
PF00174
PRIDE:
P76342
PROSITE:
PS51318
REFSEQ:
NP_416480
SMR:
P76342
UNIPROT:
P76342


Operon      
Name: msrPQ         
Operon arrangement:
Transcription unit        Promoter
msrPQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yedYp4 2039286 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2281 2039749 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB