RegulonDB RegulonDB 10.9: Gene Form
   

mtfA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mtfA serU asnT terminator TSS_2285 TSS_2285 asnTp asnTp TSS_2284 TSS_2284 mtfAp1 mtfAp1 TSS_2283 TSS_2283 serUp serUp

Gene      
Name: mtfA    Texpresso search in the literature
Synonym(s): ECK1972, G7063, b1976, yeeI
Genome position(nucleotides): 2043651 --> 2044448 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.86
External database links:  
ASAP:
ABE-0006558
ECHOBASE:
EB3159
ECOLIHUB:
mtfA
OU-MICROARRAY:
b1976
STRING:
511145.b1976
COLOMBOS: mtfA


Product      
Name: Mlc titration factor
Synonym(s): MtfA, YeeI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.279
Isoelectric point: 4.355
Motif(s):
 
Type Positions Sequence
15 -> 243 TALPWQEALSIPLLTCLTEQEQSKLVTLAERFLQQKRLVPLQGFELDSLRSCRIALLFCLPVLELGLEWLDGFHEVLIYPAPFVVDDEWEDDIGLVHNQRIVQSGQSWQQGPIVLNWLDIQDSFDASGFNLIIHEVAHKLDTRNGDRASGVPFIPLREVAGWEHDLHAAMNNIQEEIELVGENAASIDAYAASDPAECFAVLSEYFFSAPELFAPRFPSLWQRFCQFYQ

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008134 - transcription factor binding
GO:0004177 - aminopeptidase activity
GO:0008237 - metallopeptidase activity
biological_process GO:0006508 - proteolysis
GO:0043433 - negative regulation of DNA-binding transcription factor activity
GO:0051090 - regulation of DNA-binding transcription factor activity
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
[IPI] Inferred from physical interaction
Reference(s): [1] Becker AK., et al., 2006
[2] Gohler AK., et al., 2012
External database links:  
ECOCYC:
G7063-MONOMER
ECOLIWIKI:
b1976
INTERPRO:
IPR042252
INTERPRO:
IPR024079
INTERPRO:
IPR010384
PANTHER:
PTHR30164
PFAM:
PF06167
PRIDE:
P76346
PRODB:
PRO_000023301
REFSEQ:
NP_416484
SMR:
P76346
UNIPROT:
P76346


Operon      
Name: mtfA         
Operon arrangement:
Transcription unit        Promoter
mtfA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2283 2043565 reverse nd [RS-EPT-CBR] [3]
  promoter mtfAp1 2043618 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2284 2044204 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2285 2044549 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Becker AK., Zeppenfeld T., Staab A., Seitz S., Boos W., Morita T., Aiba H., Mahr K., Titgemeyer F., Jahreis K., 2006, YeeI, a Novel Protein Involved in Modulation of the Activity of the Glucose-Phosphotransferase System in Escherichia coli K-12., J Bacteriol 188(15):5439-49

 [2] Gohler AK., Staab A., Gabor E., Homann K., Klang E., Kosfeld A., Muus JE., Wulftange JS., Jahreis K., 2012, Characterization of MtfA, a novel regulatory output signal protein of the glucose-phosphotransferase system in Escherichia coli K-12., J Bacteriol 194(5):1024-35

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB