RegulonDB RegulonDB 10.9: Gene Form
   

yeeJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeeJ shiA yeeL asnT terminator TSS_2288 TSS_2288 shiAp shiAp shiAp11 shiAp11 TSS_2286 TSS_2286 yeeJp8 yeeJp8 TSS_2285 TSS_2285

Gene      
Name: yeeJ    Texpresso search in the literature
Synonym(s): ECK1974, G7064, b1978
Genome position(nucleotides): 2044938 --> 2052014 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.99
External database links:  
ASAP:
ABE-0006563
ECHOBASE:
EB3160
ECOLIHUB:
yeeJ
OU-MICROARRAY:
b1978
STRING:
511145.b1978
COLOMBOS: yeeJ


Product      
Name: inverse autotransporter adhesin
Synonym(s): YeeJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 248.568
Isoelectric point: 4.596
Motif(s):
 
Type Positions Sequence
19 -> 67 GMGIKLRRLTAGICLITQLAFPMAAAAQGVVNAATQQPVPAQIAIANAN
1458 -> 1554 EITLAASKDPVIADNNDLTTLTATVADTEGNAIANTEVTFTLPEDVKANFTLSDGGKVITDAEGKAKVTLKGTKAGAHTVTASMTGGKSEQLVVNFI
1765 -> 1856 ITSLEIPEGQVMVAQDVAVKAHVNDQFGNPVAHQPVTFSAEPSSQMIISQNTVSTNTQGVAEVTMTPERNGSYMVKASLPNGASLEKQLEAI
740 -> 834 IATLSASNNGVLANENAANTVSVNVADEGSNPINDHTVTFAVLSGSATSFNNQNTAKTDVNGLATFDLKSSKQEDNTVEVTLENGVKQTLIVSFV
959 -> 1020 MTATLQDKNGNPLKDKEITFSVPNDVASKFSISNGGKGMTDSNGVAIASLTGTLAGTHMIMA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
biological_process GO:0007155 - cell adhesion
GO:0009405 - pathogenesis
GO:0043708 - cell adhesion involved in biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Latasa C., et al., 2006
[2] Roux A., et al., 2005
External database links:  
DIP:
DIP-28072N
ECOCYC:
G7064-MONOMER
ECOLIWIKI:
b1978
INTERPRO:
IPR013783
INTERPRO:
IPR015217
INTERPRO:
IPR018392
INTERPRO:
IPR022409
INTERPRO:
IPR024519
INTERPRO:
IPR038177
INTERPRO:
IPR003535
INTERPRO:
IPR003344
INTERPRO:
IPR008964
MODBASE:
P76347
PFAM:
PF09134
PFAM:
PF02369
PFAM:
PF11924
PRIDE:
P76347
PRINTS:
PR01369
PROSITE:
PS51127
PROSITE:
PS51782
REFSEQ:
NP_416485
SMART:
SM00634
SMART:
SM00089
SMR:
P76347
UNIPROT:
P76347


Operon      
Name: yeeJ         
Operon arrangement:
Transcription unit        Promoter
yeeJ


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2285 2044549 forward nd [RS-EPT-CBR] [3]
  promoter yeeJp8 2044763 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2286 2051392 reverse nd [RS-EPT-CBR] [3]
  promoter shiAp11 2053534 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2288 2054169 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Latasa C., Solano C., Penades JR., Lasa I., 2006, Biofilm-associated proteins., C R Biol 329(11):849-57

 [2] Roux A., Beloin C., Ghigo JM., 2005, Combined inactivation and expression strategy to study gene function under physiological conditions: application to identification of new Escherichia coli adhesins., J Bacteriol 187(3):1001-13

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB