RegulonDB RegulonDB 10.9: Gene Form
   

yeeN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

amn yeeN asnW TSS_2295 TSS_2295 TSS_2294 (cluster) TSS_2294 (cluster) TSS_2293 (cluster) TSS_2293 (cluster) TSS_2292 TSS_2292 TSS_2291 TSS_2291 TSS_2290 (cluster) TSS_2290 (cluster) yeeNp4 yeeNp4 yeeNp7 yeeNp7

Gene      
Name: yeeN    Texpresso search in the literature
Synonym(s): ECK1978, G7068, b1983
Genome position(nucleotides): 2056858 --> 2057574 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.89
External database links:  
ASAP:
ABE-0006582
ECHOBASE:
EB3163
ECOLIHUB:
yeeN
OU-MICROARRAY:
b1983
STRING:
511145.b1983
COLOMBOS: yeeN


Product      
Name: putative transcriptional regulator YeeN
Synonym(s): YeeN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.867
Isoelectric point: 4.444
Motif(s):
 
Type Positions Sequence
4 -> 235 KWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNKKGGNIGAAGSVSYMFDNTGVIVFKGTDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTDLHKGIAALKAAGITEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-36184N
ECOCYC:
G7068-MONOMER
ECOLIWIKI:
b1983
INTERPRO:
IPR002876
INTERPRO:
IPR017856
INTERPRO:
IPR026562
INTERPRO:
IPR026564
INTERPRO:
IPR029072
MODBASE:
P0A8A2
PANTHER:
PTHR12532
PFAM:
PF01709
PRIDE:
P0A8A2
REFSEQ:
NP_416490
SMR:
P0A8A2
UNIPROT:
P0A8A2


Operon      
Name: yeeN         
Operon arrangement:
Transcription unit        Promoter
yeeN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeeNp7 2056754 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yeeNp4 2056792 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2290 (cluster) 2056797 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2291 2056817 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2292 2056826 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2293 (cluster) 2056836 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2294 (cluster) 2056849 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2295 2056852 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB